Property Summary

NCBI Gene PubMed Count 242
PubMed Score 0.00
PubTator Score 4524.25

Knowledge Summary

Patent

No data available

PDB (136)

Gene RIF (162)

AA Sequence

MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMV      1 - 70
YPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKH     71 - 140
FMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCV    141 - 210
DVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRL    211 - 280
TRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQA    281 - 350
VRNP                                                                      351 - 354
//

Text Mined References (248)

PMID Year Title