Property Summary

NCBI Gene PubMed Count 19
PubMed Score 2.18
PubTator Score 2.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.300 3.5e-04
atypical teratoid / rhabdoid tumor -2.300 1.6e-08
Breast cancer -2.200 3.0e-02
breast carcinoma -1.500 3.4e-04
ductal carcinoma in situ -2.200 1.4e-04
ependymoma -1.100 1.8e-04
glioblastoma -1.400 3.2e-05
group 3 medulloblastoma -1.500 6.6e-03
invasive ductal carcinoma -1.193 1.9e-03
lung adenocarcinoma -2.300 1.2e-09
lung cancer -2.600 1.0e-05
malignant mesothelioma -6.700 1.9e-09
medulloblastoma, large-cell -2.400 4.9e-06
mucosa-associated lymphoid tissue lympho... 1.617 4.7e-03
non-small cell lung cancer -1.459 1.9e-18
osteosarcoma -2.028 9.5e-03
pancreatic cancer 1.300 1.2e-04
pancreatic carcinoma 1.300 1.2e-04
pancreatic ductal adenocarcinoma liver m... -1.172 2.5e-02
psoriasis -1.800 3.3e-04
subependymal giant cell astrocytoma -1.657 8.9e-03

Gene RIF (1)

AA Sequence

MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYIC      1 - 70
TQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMASS     71 - 140
KPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGIKC    141 - 210
ETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETS    211 - 280
ISPPGSSIGSPNRVICAKVDNEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYMSDEMLERCGYGESL    281 - 350
GTLSPYSQDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSS    351 - 420
TPTSYQAPKHFHIPAGDSNIYRKPPIYKRHGDLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTY    421 - 490
HGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGY    491 - 560
EMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTT    561 - 630
RGRNRLPKDVDRTRLERHLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF                     631 - 683
//

Text Mined References (25)

PMID Year Title