Property Summary

NCBI Gene PubMed Count 28
PubMed Score 10.77
PubTator Score 8.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.364 3.0e-02
malignant mesothelioma 2.900 6.9e-08
psoriasis -3.400 6.2e-05
osteosarcoma -2.283 2.0e-03
cystic fibrosis -2.474 2.0e-07
astrocytoma 1.200 4.0e-02
glioblastoma -1.400 3.5e-02
medulloblastoma -1.200 1.1e-02
medulloblastoma, large-cell -1.100 4.8e-02
autosomal dominant Emery-Dreifuss muscul... 1.785 3.2e-04
limb girdle muscular dystrophy 2I 1.192 2.0e-03
fascioscapulohumeral muscular dystrophy 1.504 1.1e-04
acute quadriplegic myopathy 1.262 4.1e-05
adrenocortical carcinoma -3.001 5.5e-05
tuberculosis -1.200 3.0e-04
Common variable immunodeficiency -1.002 6.4e-03
intraductal papillary-mucinous adenoma (... 2.600 4.2e-04
intraductal papillary-mucinous carcinoma... 2.200 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.600 4.5e-02
breast carcinoma -1.500 3.4e-07
interstitial cystitis -1.200 6.8e-05
lung adenocarcinoma -1.800 5.3e-13
pediatric high grade glioma -1.100 7.7e-03
subependymal giant cell astrocytoma -1.377 3.5e-02
invasive ductal carcinoma -2.000 6.9e-03
nasopharyngeal carcinoma -1.400 3.6e-04
lung carcinoma -1.500 3.1e-13
spina bifida -2.040 3.7e-02
ductal carcinoma in situ -1.300 2.9e-03
ovarian cancer -1.800 4.7e-04
Breast cancer 1.700 5.0e-02

 MGI Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (5)

PMID Text
25403273 Exon 11 inclusion isoform of ABLIM1 may have a muscle-specific function, and its abnormal splicing could be related to muscle symptoms of myotonic dystrophy type 1.
21547531 SNP rs727532 in ABLIM1 (10q25) had significant association in the multivariate test & strong associations with novelty seeking, harm avoidance, reward dependence and alcohol dependence in the COGA sample.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPAFLGLKCLGKLCSSEKSKVTSSERTSARGSNRKRLIVEDRRVSGTSFTAHRRATITHLLYLCPKDYCP      1 - 70
RGRVCNSVDPFVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIK     71 - 140
NGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA    141 - 210
QPMSSSPKETTFSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEYISKDGAPYCEKDYQGL    211 - 280
FGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTR    281 - 350
TSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQER    351 - 420
QSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNS    421 - 490
PLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSE    491 - 560
TPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRER    561 - 630
SSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMR    631 - 700
MDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRND    701 - 770
MKKKAKLF                                                                  771 - 778
//

Text Mined References (40)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25403273 2015 ABLIM1 splicing is abnormal in skeletal muscle of patients with DM1 and regulated by MBNL, CELF and PTBP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22684256 2012 miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21547531 2012 Polymorphisms in ABLIM1 are associated with personality traits and alcohol dependence.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17194709 2007 Two novel members of the ABLIM protein family, ABLIM-2 and -3, associate with STARS and directly bind F-actin.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15570572 2005 Automated immobilized metal affinity chromatography/nano-liquid chromatography/electrospray ionization mass spectrometry platform for profiling protein phosphorylation sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15024025 2004 Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
9417918 1997 Limatin (LIMAB1), an actin-binding LIM protein, maps to mouse chromosome 19 and human chromosome 10q25, a region frequently deleted in human cancers.
9245787 1997 Molecular characterization of abLIM, a novel actin-binding and double zinc finger protein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.