Property Summary

NCBI Gene PubMed Count 69
PubMed Score 62.25
PubTator Score 44.93

Knowledge Summary

Patent (8,984,519)

Expression

  Differential Expression (4)

Disease log2 FC p
tuberculosis -1.200 2.9e-05
intraductal papillary-mucinous neoplasm ... -1.100 1.2e-02
group 3 medulloblastoma 1.200 1.1e-03
ovarian cancer 1.300 6.4e-06

 GWAS Trait (1)

Protein-protein Interaction (8)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (26)

PMID Text
25694433 Two distinct interfaces mediate direct binding of integrin beta1 with Arg in vitro and in cells and promote Arg kinase activation.
25373509 the ETV6/ARG oncoprotein contributes to autonomous cell growth by compensating for the requirement of growth factor through activating STAT5 signaling, which leads to the up-regulation of c-Myc.
24464651 Knockdown of ABL2 promoted cell invasion and migration and we identified miR-20a-induced cell invasion and migration can be rescued by ABL2.
24096484 Data shows that c-Abl and Arg induce NM23-H1 degradation by increasing expression and activation of cathepsin L and B, which directly cleave NM23-H1 in the lysosome.
23707396 ARG isoforms's cellular location modulate cell morphology, motility, the cytoskeleton, and focal adhesions.
23648710 data provide evidence that Aurora A, AMPK, ABL and CDKs are functionally integrated into human cytomegalovirus (HCMV) replication; inhibition of AMPK and ABL kinases exerted a negative effect, inhibition of Aurora A kinase a slightly positive effect on HCMV replication
23552693 Beta1 integrin regulates Arg to promote invadopodial maturation and matrix degradation.
22777352 Arg acts as a switch in metastatic cancer cells that governs the decision to 'grow or go' (divide or invade).
21892207 c-Abl and Arg not only promote in vitro processes important for melanoma progression, but also promote metastasis in vivo
21543883 Knockout mutation of p27-p55 operon in Mycobacterium bovis severely decreased the virulence of the bacteria when assessed in a progressive model of pulmonary tuberculosis in Balb/c mice.
21257711 Our findings suggest a novel mechanism by which an EGFR-Src-Arg-cortactin pathway mediates functional maturation of invadopodia and breast cancer cell invasion
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20448119 A 35-bp insertion in the BCR-ABL2 gene is associated with resistance to tyrosine kinase inhibitors, but sensitivity to omacetaxine in chronic myelogenous leukemia.
20150913 The Arg tyrosine kinase regulated lysosomal degradation of antiapoptotic Gal3 may provide one of the important arms in Arg tyrosine kinase dependent antiapoptotic pathways.
20077570 Results describe the NMR structure of human Arg F-actin-binding domain.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19275932 Abl kinases not only are activated by PDGFR and promote PDGFR-mediated proliferation and migration, but also act in an intricate negative feedback loop to turn-off PDGFR-mediated chemotaxis.
18660502 ABL2/ARG is a novel mediator of SEMA3F-induced RhoA inactivation and collapsing activity.
16678104 The present study demonstrates that c-Abl and Arg (abl-related gene) tyrosine kinases associate with and phosphorylate the proteasome PSMA7 (alpha4) subunit at Tyr-153.
15729383 several critical domains within TEL/ARG necessary for function
15679048 High Arg expression is correlated with thymoma stage
12950161 findings indicate that, in addition to stimulating catalase activity, c-Abl and Arg promote catalase degradation in the oxidative stress response
12777400 c-Abl and Arg regulate catalase and that this signaling pathway is of importance to apoptosis in the oxidative stress response
12374288 Review. ABL protein tyrosine kinases regulate cell proliferation, survival, adhesion, migration, stress responses, and cytoskeletal dynamics.
12220663 The highest Arg transcript and protein levels are in the mature B cells.

AA Sequence

MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHDHFASCVEDGFEGDKTGG      1 - 70
SSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYN     71 - 140
QNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSIS    141 - 210
LRYEGRVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDK    211 - 280
WEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGV    281 - 350
CTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN    351 - 420
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGID    421 - 490
LSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAA    491 - 560
SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDK    561 - 630
SPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADG    631 - 700
FSFTPAQQEANLVPPKCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTA    701 - 770
SDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEES    771 - 840
AAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLGMAGVPEDGEQ    841 - 910
PGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKP    911 - 980
KCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKAGRPVMPPPQVPLPT    981 - 1050
SSISPAKMANGTAGTKVALRKTKQAAEKISADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYC   1051 - 1120
SGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR           1121 - 1182
//

Text Mined References (91)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
25694433 2015 Direct interactions with the integrin ?1 cytoplasmic tail activate the Abl2/Arg kinase.
25373509 2015 ETV6/ARG oncoprotein confers autonomous cell growth by enhancing c-Myc expression via signal transducer and activator of transcription 5 activation in the acute promyelocytic leukemia cell line HT93A.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24464651 2014 miR-20a promotes prostate cancer invasion and migration through targeting ABL2.
24367707 2013 Abl family kinases regulate endothelial barrier function in vitro and in mice.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24096484 2014 c-Abl and Arg induce cathepsin-mediated lysosomal degradation of the NM23-H1 metastasis suppressor in invasive cancer.
23707396 2013 One isoform of Arg/Abl2 tyrosine kinase is nuclear and the other seven cytosolic isoforms differently modulate cell morphology, motility and the cytoskeleton.
23648710 2013 Profiling of the kinome of cytomegalovirus-infected cells reveals the functional importance of host kinases Aurora A, ABL and AMPK.
23552693 2013 ?1 integrin regulates Arg to promote invadopodial maturation and matrix degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22777352 2013 Arg/Abl2 promotes invasion and attenuates proliferation of breast cancer in vivo.
22297987 2012 Lysozyme contamination facilitates crystallization of a heterotrimeric cortactin-Arg-lysozyme complex.
22036096 2011 A genome-wide meta-analysis of genetic variants associated with allergic rhinitis and grass sensitization and their interaction with birth order.
21892207 2012 c-Abl and Arg are activated in human primary melanomas, promote melanoma cell invasion via distinct pathways, and drive metastatic progression.
21543883 Knockout mutation of p27-p55 operon severely reduces replication of Mycobacterium bovis in a macrophagic cell line and survival in a mouse model of infection.
21417343 2011 Crystal structures of ABL-related gene (ABL2) in complex with imatinib, tozasertib (VX-680), and a type I inhibitor of the triazole carbothioamide class.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21257711 2011 An EGFR-Src-Arg-cortactin pathway mediates functional maturation of invadopodia and breast cancer cell invasion.
20841568 2010 ABL tyrosine kinases: evolution of function, regulation, and specificity.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20598684 2010 Abi1/Hssh3bp1 pY213 links Abl kinase signaling to p85 regulatory subunit of PI-3 kinase in regulation of macropinocytosis in LNCaP cells.
20448119 2010 Successful treatment using omacetaxine for a patient with CML and BCR-ABL1 [corrected] 35INS.
20150913 2010 c-Abl and Arg tyrosine kinases regulate lysosomal degradation of the oncoprotein Galectin-3.
20077570 2010 NMR structure of F-actin-binding domain of Arg/Abl2 from Homo sapiens.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19381274 2009 Unc119 protects from Shigella infection by inhibiting the Abl family kinases.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19275932 2009 Reciprocal regulation of Abl and receptor tyrosine kinases.
18945674 2008 Abl kinases regulate autophagy by promoting the trafficking and function of lysosomal components.
18810762 2008 Eight full-length abelson related gene (Arg) isoforms are constitutively expressed in caki-1 cell line and cell distribution of two isoforms has been analyzed after transfection.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660502 2008 ABL2/ARG tyrosine kinase mediates SEMA3F-induced RhoA inactivation and cytoskeleton collapse in human glioma cells.
18182299 2008 Emerging roles of Abl family tyrosine kinases in microbial pathogenesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17910947 2007 Identification of twinfilin-2 as a factor involved in neurite outgrowth by RNAi-based screen.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17306540 2007 A critical role for cortactin phosphorylation by Abl-family kinases in PDGF-induced dorsal-wave formation.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16678104 2006 Interaction between c-Abl and Arg tyrosine kinases and proteasome subunit PSMA7 regulates proteasome degradation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15886098 2005 RIN1 is an ABL tyrosine kinase activator and a regulator of epithelial-cell adhesion and migration.
15765532 2005 N- and C-terminal isoforms of Arg quantified by real-time PCR are specifically expressed in human normal and neoplastic cells, in neoplastic cell lines, and in HL-60 cell differentiation.
15735735 2005 Ubiquitination and degradation of the Arg tyrosine kinase is regulated by oxidative stress.
15729383 2005 Signal transduction and cellular functions of the TEL/ARG oncoprotein.
15679048 2004 Arg and DAP3 expression was correlated with human thymoma stage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14729179 2004 How do Abl family kinases regulate cell shape and movement?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12950161 2003 Catalase is regulated by ubiquitination and proteosomal degradation. Role of the c-Abl and Arg tyrosine kinases.
12893824 2003 Glutathione peroxidase 1 is regulated by the c-Abl and Arg tyrosine kinases.
12777400 2003 Catalase activity is regulated by c-Abl and Arg in the oxidative stress response.
12775773 2003 Regulation of F-actin-dependent processes by the Abl family of tyrosine kinases.
12748290 2003 Two distinct phosphorylation pathways have additive effects on Abl family kinase activation.
12569093 2003 Functional interaction between the c-Abl and Arg protein-tyrosine kinases in the oxidative stress response.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406085 2002 Identification of an ETV6-ABL2 fusion transcript in combination with an ETV6 point mutation in a T-cell acute lymphoblastic leukaemia cell line.
12374288 2002 The Abl family kinases: mechanisms of regulation and signaling.
12220663 2002 The expression of the non-receptor tyrosine kinases Arg and c-abl is differently modulated in B lymphoid cells at different stages of differentiation.
12198159 2002 Tyrosine 221 in Crk regulates adhesion-dependent membrane localization of Crk and Rac and activation of Rac signaling.
11956190 2002 Sphingosine 1-phosphate induces membrane ruffling and increases motility of human umbilical vein endothelial cells via vascular endothelial growth factor receptor and CrkII.
11494128 2001 Multiple signaling interactions of Abl and Arg kinases with the EphB2 receptor.
11278261 2001 The ARG tyrosine kinase interacts with Siva-1 in the apoptotic response to oxidative stress.
10892742 2000 Repulsive axon guidance: Abelson and Enabled play opposing roles downstream of the roundabout receptor.
10706884 2000 A new ETV6/TEL partner gene, ARG (ABL-related gene or ABL2), identified in an AML-M3 cell line with a t(1;12)(q25;p13) translocation.
10590083 1999 The tyrosine kinase abl-related gene ARG is fused to ETV6 in an AML-M4Eo patient with a t(1;12)(q25;p13): molecular cloning of both reciprocal transcripts.
10521789 1999 Comparative tyrosine-kinase profiles in colorectal cancers: enhanced arg expression in carcinoma as compared with adenoma and normal mucosa.
9211900 1997 ArgBP2, a multiple Src homology 3 domain-containing, Arg/Abl-interacting protein, is phosphorylated in v-Abl-transformed cells and localized in stress fibers and cardiocyte Z-disks.
8875975 1996 Proline-rich sequences mediate the interaction of the Arg protein tyrosine kinase with Crk.
8700546 1996 Subcellular localization of the Arg protein tyrosine kinase.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
3787260 1986 A novel human gene closely related to the abl proto-oncogene.
2198571 1990 The complete coding sequence of arg defines the Abelson subfamily of cytoplasmic tyrosine kinases.
1383690 1992 A limited set of SH2 domains binds BCR through a high-affinity phosphotyrosine-independent interaction.