Property Summary

NCBI Gene PubMed Count 629
PubMed Score 3222.22
PubTator Score 4611.85

Knowledge Summary

Patent (329,475)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Immune system cancer 38 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 6.58 3.3
Disease Target Count Z-score Confidence
Polycythemia Vera 24 5.209 2.6
Hemorrhagic disease 11 4.524 2.3

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma 1.200 1.5e-02
osteosarcoma 1.123 1.8e-02
astrocytoma 2.100 6.6e-04
atypical teratoid / rhabdoid tumor 1.100 2.9e-05
group 4 medulloblastoma 1.500 1.0e-07
juvenile dermatomyositis 1.147 9.4e-13
tuberculosis -1.200 1.9e-07
primary pancreatic ductal adenocarcinoma 1.164 4.8e-02
ovarian cancer 2.000 7.6e-05
Down syndrome 1.200 5.3e-04
pancreatic cancer 1.100 3.3e-02

Synonym

Accession P00519 A3KFJ3 Q13869 Q13870 Q16133 Q17R61 Q45F09
Symbols ABL
JTK7
p150
c-ABL
v-abl
c-ABL1
bcr/abl

Gene

PDB

4J9D   4J9F   5DC0   5DC4   5DC9   1AB2   1ABL   1AWO   1BBZ   1JU5   1OPL   1ZZP   2ABL   2E2B   2F4J   2FO0   2G1T   2G2F   2G2H   2G2I   2GQG   2HIW   2HYY   2HZ0   2HZ4   2HZI   2O88   2V7A   3CS9   3EG0   3EG1   3EG2   3EG3   3EGU   3K2M   3PYY   3QRI   3QRJ   3QRK   3T04   3UE4   3UYO   4J9B   4J9C   4J9E   4J9G   4J9H   4J9I   4JJB   4JJC   4JJD   4TWP   4WA9   4XEY   4YC8   4ZOG   5HU9  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (2)

Gary Johnson 302 Kinome profile via MIB/MS Technology
Michael McManus 22 Genetic interaction screen

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
602398 confirmatory 20 / 0 / 3 Late stage assay for the probe development effort to identify inhibitors of the interaction of the Ras and Rab interactor 1 protein (Rin1) and the c-abl oncogene 1, non-receptor tyrosine kinase (Abl): TRFRET-based biochemical dose response assay for inhibitors of Rin1-Abl interactions

Gene RIF (438)

PMID Text
27273956 BCR-ABL1 transcript types found in Syria were similar to that of Indian Far-Eastern, African or European populations. The M-BCR rearrangement types were not dependent on white blood count, platelet count, hemoglobin level or gender of the patients.
27018250 mammalian c-Abl plays an important role in steroid hormone receptor-mediated transcription by regulating RBM39
26838548 ABL kinases promote breast cancer osteolytic metastasis by modulating tumor-bone interactions through TAZ and STAT5 signaling.
26831735 Data suggest elevated interleukin-1beta secretion from tyrosine kinase inhibitor- (TKI-)resistant chronic myeloid leukemia (CML) cells contributes to TKI/imatinib resistance via promotion of cell viability/migration; cells used lack BCR-ABL mutation.
26721204 Blockade of the interaction between Bcr-Abl and PTB1B by small molecule SBF-1 to overcomes imatinib-resistance of K562 cells.
26607903 Suggest that AIC-47 in combination with imatinib strengthened the attack on cancer energy metabolism in BCR-ABL-harboring leukemic cells.
26429164 loss of expression or even the down-regulation of c-abl, but not WYHAZ, is a fundamental event that leads to genesis and progression of tumors
26429162 analysis of WT1 and M-BCR-ABL expressions in chronic myeloid leukemia reveals that high WT1 expression in CML patients is detected especially in the advanced stages of the disease
26295305 Identify a novel BCR-ABL/IkappaBalpha/p53 network, whereby BCR-ABL functionally inactivates a key tumor suppressor in chronic myeloid leukemia.
26291129 demonstrated that depletion of endogenous MAPK15 expression inhibited BCR-ABL1-dependent cell proliferation
26252834 Molecular rearrangements and the minimal residual disease follow-up for 5 chronic myeloid leukaemia patients; 3 resulted from new rearrangements between the BCR and ABL1 sequences (the breakpoints being located within BCR exon 13 in 2 cases and within BCR exon 18 in one case). The other 2 cases revealed a complex e8-[ins]-a2 fusion transcript involving a 3rd partner gene.
26217035 JunB is likely to be a key target of c-Abl in expression of p21 in Adriamycin-induced DDR.
26203192 Findings suggest that proto-oncogene protein c-abl promotes hepatitis C virus (HCV) paoticle assembly by phosphorylating nonstructural protein 5A (NS5A) at Tyr(330).
26186983 Data sugget that the acquisition of additional BCR-ABL1 fusion genes in chronic myeloid leukemia (CML) in the blast phase (BP) through mitotic recombination between the derivative chromosome and the normal homologue.
26179066 we describe a regulatory pathway modulating BCR and BCR/ABL1 expression, showing that the BCR promoter is under the transcriptional control of the MYC/MAX heterodimer.
26152360 Deleterious c-Cbl Exon Skipping Contributes to Glioma.
26126715 These results reveal a new pathway in the DNA damage response wherein ABL-dependent tyrosine phosphorylation of DGCR8 stimulates the processing of selective primary miRNAs.
26087013 Separase protein levels decrease and Separase proteolytic activity increases exclusively in b3a2 p210BCR-ABL-positive cell lines under Imatinib treatment.
26072332 Expression of the ETS transcription factor GABPalpha is positively correlated to the BCR-ABL1/ABL1 ratio in CML patients and affects imatinib sensitivity in vitro.
25999467 ABL phosphorylates tyrosine 137 of H-, K-, and NRAS.
25997600 single oncogenic lesion triggers DNA methylation changes
25944899 c-Abl was required for endogenous HIPK2 accumulation and phosphorylation of p53 at Ser46 in response to DNA damage by gamma- and UV radiation.
25911675 Our results link FGF8, c-Abl and p300 in a regulatory pathway that controls DeltaNp63alpha protein stability and transcriptional activity.
25883211 High cABL expression is associated with triple-negative breast cancer.
25795725 LPS-induced paxillin phosphorylation at Y31 and Y118 was mediated by c-Abl tyrosine kinase
25769542 Expression profiling of adult acute lymphoblastic leukemia identifies a BCR-ABL1-like subgroup characterized by high non-response and relapse rates.
25756742 our results confirm that not obtaining a BCR-ABL/ABL ratio of </=10% at 3 months is a warning sign because it compromises the potential response to treatment even when switching to a 2GTKI.
25740611 BCR- ABL1 mutations are associated with the clinical resistance, but may not be considered the only cause of resistance to imatinib.
25730044 expression of the BCR-ABL gene were confirmed by FISH, which revealed a high concordance (100%) rate. We found that real-time RT-qPCR is more reliable and should be used in Moroccan biomedical analysis laboratories to monitor CML progression
25648025 Leptin levels were increased in BCR-ABL p210 positive chronic myeloid leukemia patients.
25644089 AIC-47, acting through the PPARgamma/beta-catenin pathway, induced down-regulation of c-Myc, leading to the disruption of the bcr-abl/mTOR/hnRNP signaling pathway, and switching of the expression of PKM2 to PKM1 in acute myeloid leukemia.
25620702 c-Abl regulates proteasome abundance by controlling the ubiquitin-proteasomal degradation of PSMA7 subunit
25615000 Lack of response to tyrosine kinase inhibitors associated with mutation in the BCR-ABL gene was significantly higher in imatinib-treated patients, and all mutations arose after treatment. T315I was a common treatment-emergent mutation
25561363 c-Abl induces HDAC1 stabilization possibly through phosphorylation of a cytoplasmic target that is involved in proteasomal degradation of HDAC1.
25527259 In conclusion, specific c-Abl gene silencing using siRNA effectively reduced fibrosis-related gene expression. Inhibition of c-Abl by siRNA may be a potential therapeutic approach for fibrotic diseases such as systemic sclerosis.
25418123 By visually examining the dynamics behavior, structural basis and energetic property of few typical Abl-drug complex cases, a significantly different pattern of non-bonded interactions between the binding of drug ligands to Abl receptor was revealed.
25368164 PPARgamma2 physically associated with c-Abl and was phosphorylated on 2 Tyr residues in its regulatory activation function 1 domain. This positively regulates PPARgamma2 stability and adipogenesis. c-Abl binding to PPARgamma2 required the Pro12 residue.
25293778 BCR-ABL1 kinase-dependent and -independent mechanisms convert p27 from a nuclear tumor suppressor to a cytoplasmic oncogene.
25248240 This paper proposes a scheme for dealing with the diagnosis and monitoring of minimal residual disease (MRD) in patients with CML treated with tyrosine kinase inhibitors (TKIs) in the presence of rare fusion of the BCR and ABL genes.
25233427 Data (including data from mouse mutant strains) suggest that neuropilin-1 in vascular endothelium contributes to angiogenesis via VEGFA-independent mechanism involving ABL1 signaling in the extracellular matrix in VEGFA-independent mechanism. [REVIEW]
25219501 The c-Abl/HDAC2 signaling pathway participates in the epigenetic blockade of gene expression in Alzheimer's disease pathology.
25213664 The epigenetic silencing of miR-23a led to derepression of BCR/ABL expression, and consequently contributes to CML development and progression.
25134459 STAT3 is a critical signaling node in BCR-ABL1 tyrosine kinase-independent leukemia resistance that is reversed by a discovered BP-5-087.
25132497 BCR-ABL1 compound mutants confer different levels of tyrosine kinase inhibitor resistance, necessitating rational treatment selection to optimize clinical outcome.
25052580 Taken together, NS1 proteins of avian influenza A viruses interfere with the kinase activity of c-Abl, a major cellular signalling integrator that controls multiple signalling processes and cell fate regulations apparently including virus infections.
24967705 ATRA treatment decreased DNA damage repair and suppressed acquisition of BCR-ABL mutations
24939418 Combined treatment with bortezomib and As2O3 downregulates Bcr/Abl mRNA and protein expression.
24903628 Findings show that residual Ph(+) cells are low BCR-ABL1 producers, and that DNA-based methods are required to assess the content of persisting Ph(+) stem cells in these patients.
24891505 Two amino acid residues confer different binding affinities of Abelson family kinase SRC homology 2 domains for phosphorylated cortactin.
24872081 HIV-1 Tat-mediated inhibition of miR-196a leads to upregulation of p73 and c-ABL protein expression in cells
24856998 Co-expression of EVI1 and BCR/ABL fusion gene can be found in childhood CML and ALL.
24837466 Clinical outcome under imatinib treatment was comparable and no risk prediction can be made according to e13a2 versus e14a2 BCR-ABL1 transcript type at diagnosis.
24836440 Although BCR-ABL induces STAT5-tyrosine phosphorylation independent of JAK2-kinase activity, BCR-ABL is less efficient in inducing active STAT5A:STAT5B-heterodimerization than IL-3.
24779036 we confirm the presence at diagnosis of the BCR-ABL1 fusion gene in myeloid cell lineages from CML patients,including also in a significant fraction of cases, a smaller percentage of T, B, and NK lymphocytes.
24775308 Results show that Janus kinase 2 inhibitors may enhance the cytotoxic effect of ABL kinase inhibitor imatinib against residual chronic myeloid leukemia (CML) cells.
24617663 Altered protein distribution in chronic myeloid leukemia dendritic cells was associated with defective generation of ABL1-dependent maturation signals and a dislocation of ABL1 from the F-actin cytoskeleton.
24550512 Molecular dynamics reveal BCR-ABL1 polymutants as a unique mechanism of resistance to PAN-BCR-ABL1 kinase inhibitor therapy.
24520051 the functional relationship between Abl and CLASP2 is conserved and provides a means to control the CLASP2 association with the cytoskeleton.
24487968 C817 is a promising compound for treatment of CML patients with Bcr-Abl kinase domain mutations that confer imatinib resistance.
24456693 Serial monitoring of BCR-ABL1 transcripts in chronic myeloid leukemia (CML) patients allows appropriate selection of CML patients for BCR-ABL1 kinase domain mutation analysis associated with acquired Tyrosine kinase inhibitors resistance.
24412932 c-Abl-mediated phosphorylation of Y39 play a role in regulating alpha-syn clearance and contribute to the pathogenesis of Parkinson's disease.
24392933 C-Abl is recruited to the equator during cytokinesis.
24269846 Data indicate that BCR-ABL mRNA and phosphorylation of BCR protein were upregulated in K562/Adh cell.
24262285 Data show that factors associated with not attaining a major molecular response (MMR) were the presence of the minor BCR-ABL1 fusion gene, a low dose of tyrosine kinase inhibitor (TKI), and the kinase domain mutations conferring resistance to imatinib.
24223753 Abl1 knockdown partially phenocopies miR-4723 reexpression in prostate cancer, suggesting that Abl1 is a functionally relevant target of miR-4723.
24190424 overexpression of Egr-1 decreased c-Abl activity independent of endogenous Egr-1 inhibition by siRNA-Egr-1.
24177958 The c-ABL appears to promote senescence or inhibit apoptosis to be the p21 induction by p53 in response to DNA damage.
24112389 Altered expression of Abl in airway smooth muscle may play a critical role in the development of airway hyperresponsiveness and airway remodeling in asthma.
24041959 The results suggest that nuclear c-Abl plays critical roles in actin dynamics within the nucleus.
23980151 monobodies targeting the N-SH2 domain disrupted the interaction of SHP2 with its upstream activator, the Grb2-associated binder 2 adaptor protein, suggesting decoupling of SHP2 from the BCR-ABL protein complex
23974192 Higher cumulative incidence of relapse was found for BCR-ABL1-like and IKZF1-deleted, but not CRLF2-high, cases relative to remaining BCP-ALL cases.
23959873 Results indicate a thermodynamic rationale for the involvement of N-cap and SH3-SH2 connector in Abl kinase regulation.
23934627 Bcr-Abl activates AURKA and AURKB in chronic myeloid leukemia cells via AKT signaling.
23928308 the N-Cap of c-Abl and the Src homology (SH) 3 domain acquire mus-ms motions upon N-Cap association with the SH2-L domain, revealing a stabilizing synergy between these segments
23894305 A low level of expression of miR-196b can cause up-regulation of BCR-ABL1 and HOXA9 expression, which leads to the development of chronic myeloid leukemia.
23892407 Inhibition of c-Abl inactivated IkappaBalpha/NF-kappaB pathway is associated with IkappaBalpha tyrosine phosphorylation in breast cancer cells.
23872305 NUP214-ABL1-mediated cell proliferation in T-cell acute lymphoblastic leukemia is dependent on the LCK kinase and various interacting proteins.
23840065 identify a unique dual role for Abl kinases in the regulation of angiopoietin/Tie2 protein kinase signaling
23831022 analysis of the recognition sequence for DJ-1 protease and its interactions with KIF1B and ABL1
23799845 The data suggest that some BCR-ABL1 mutations may persist at undetectable levels for many years after changing therapy, and can be reselected and confer resistance to subsequent inhibitors.
23788109 Silencing of both BCR-ABL siRNA and GFI1B siRNA is associated with an additive antileukemic effect against K562 cells.
23749639 our results identify eIF4B as a critical substrate of Pim kinases in mediating the activity of Abl oncogenes
23740246 Data indicate that Abi1 is activated by the c-Abl-Crk-associated substrate (CAS) pathway, and Abi1 reciprocally controls the activation of its upstream regulator c-Abl.
23723070 Data indicate that AMP-dependent kinases (AMPKalpha1 and AMPKalpha2) inhibit caveolin-1 phosphorylation by stabilizing the interaction between c-Abl and Prdx-1.
23716543 The BCR-ABLT315I mutation has a significant negative impact on overall survival in chronic phase chronic myelogenous leukemia patients resistant to tyrosine kinase inhibitors.
23691243 WAVE2 complex regulates breast epithelial morphology by a complex mechanism involving repression of Twist1 expression and Abl kinase activity
23667855 The major BCR/ABL translocation (b3a2 type)was found by real-time PCR.
23513809 Chronic myelocytic leukemia is a representative condition caused by ABL1 fusion gene. An outstanding recent development is effective treatment using an ABL1 tyrosine kinase inhibitor, imanitib mesyalte.
23458731 Suggest the existence of a feed-forward loop accelerating chronic myeloid leukemia progression, in which BCR-ABL1 enhances its own mutation rate in a STAT5-reactive oxygen species dependent manner.
23448894 Studies indicate that compound mutations are common in patients with two BCR-ABL1 mutations and frequently reflect a highly complex clonal network.
23433665 26% of chronic-phase & 67% of accelerated/blast-crisis CML had ABL kinase-domain mutations. 3 had mutations in the P-loop at AAs 244, 250 & 253. 11 had mutations outside the P-loop at AAs 276, 277, 311, 315, 317, 340, 351, 359, 379 & 417.
23428668 miR-29b may function as a tumor suppressor by targeting ABL1 and BCR/ABL1.
23383002 p140Cap phosphorylation sites and binding to Csk and Abl kinase
23325923 c-Abl tyrosine kinase plays a critical role in beta2 integrin-dependent neutrophil migration by regulating Vav1 activity.
23319661 Data indicate that van der Waals interactions involved the stabilization of Gleevec in the binding pocket of Abl.
23318434 Abl signaling can indirectly augment acetylation of Myc by p300, and its transcriptional activity in the nucleus; Abl can directly phosphorylate Myc on tyrosine and its presence correlates with Abl activation in cancer.
23316053 Structure and dynamic regulation of Abl kinases
23303187 Enhanced SH3/linker interaction overcomes Abl kinase activation by gatekeeper and myristic acid binding pocket mutations and increases sensitivity to small molecule inhibitors.
23289634 Twenty-three BCR-ABL1 mutations were detected in 21 chronic myeloid leukemia (CML) patients and were detected across the kinase domain, and were associated with specific tyrosine kinase inhibitor TKI resistance.
23289360 The BCR-ABL1 T315I mutation is associated with tyrosine kinase inhibitor resistance and disease progression in patients with chronic myelogenous leukemia.
23287430 miR-30a acts as a tumor suppressor by downregulating ABL1 and BCR-ABL1 expression.
23277196 Studies indicate new generations of BCR-ABL kinase inhibitors and alternative targeting strategies for the effective treatment options for imatinib-resistant patients.
23269583 we report the frequencies of M-BCR-ABL fusion transcripts in 44 chronic myeloid leukemia patients
23223358 We conclude that compound mutations are common in patients with sequencing evidence for 2 BCR-ABL1 mutations and frequently reflect a highly complex clonal network.
23207522 RhoGEF activity of p210 BCR/ABL directly contributes to transforming activity, and may account for the difference in disease outcome associated with p190 BCR/ABL and p210 BCR/ABL.
23201011 Dihydroartemisinin could also lead to the inhibition of the Bcr/Abl protein expression.
23171811 all 7 reported acute lymphoblastic leukemia patients possess the type A ETV6/ABL1 fusion transcript, composed of the first 4 exons of ETV6 fused to the second exon of ABL1.
23146907 results indicate that Abl kinases negatively regulate HNSCC invasive processes through suppression of an HB-EGF autocrine loop responsible for activating a EGFR-Src-cortactin cascade
23130349 The majority of BCR/ABL kinase domain mutations resulting in imatinib resistance are missense mutations, comprising more than 95% of the known mutations.
23124138 TC48 dephosphorylates BCR-Abl but not c-Abl and inhibits its activity towards its substrate.
23117882 results establish that AXL promotes cisplatin resistance in esophageal adenocarcinoma and argue that therapeutic targeting of AXL may sensitize these cancers to DNA-damaging drugs
23087049 Abl knockdown attenuated the redistribution of Raf-1 and cell proliferation, which were restored by Abl reexpression
23065514 the quantitative level of mutant T315I allele is predictive of major molecular response at 12 months on second-line nilotinib or dasatinib treatment.
23062378 study demonstrates kinetics of different BCR-ABL1 mutant emergence and an association between BCR-ABL1 mutations and progression of chronic myeloid leukemia
23062104 report of rare, concomitant occurrence of Janus kinase 2 V617F mutation with BCR-ABL (breakpoint cluster region--c-abl oncogene 1 fusion protein) translocation at presentation in five patients with atypical myeloproliferative neoplasm [CASE REPORT]
23053188 ABL-kinase-domain mutations of BCR-ABL proteins in elderly chronic-phase myeloid leukemia patients lessened the response to dasatinib, increased resistance, & lowered survival.
23044928 Novel patient-derived BCR/ABL mutants show different sensitivity to second and third generation tyrosine kinase inhibitors.
23009571 ABL kinase domain mutations in patients with chronic myeloid leukemia in Jordan
22988030 Abl tyrosine kinase, a master switch for cell growth and trafficking of intracellular organelles, controls the acidification of lysosomes in human macrophages.
22976291 Findings suggest that RIN1 orchestrates RAB5 activation, ABL kinase activation and BIN1 recruitment to determine EGFR fate.
22957062 Knocking down low molecular weight protein tyrosine phosphatase (LMW-PTP) reverts chemoresistance through inactivation of Src and Bcr-Abl proteins
22879933 These studies implicate ASM as a mediator of apoptosis induced by inhibition of integrins alphavbeta3/alphavbeta5, and for the first time place c-Abl as an upstream regulator of ASM expression and activity.
22870928 Data indicate that mutations in the tyrosine kinase domain of chimerical BCR-ABL1 gene were identified 11/32 chronic myeloid leukemia (CML) cases.
22865780 clinical data support a role for enhanced PDGF/Abl signaling in AI-resistant disease and provide a rationale for targeting the pathway in endocrine-resistant breast cance
22847163 case series examined the clinical, histopathologic, and genetic features of 3 patients with myeloproliferative neoplasms characterized by concomitant BCR-ABL1 translocation and JAK2(V617F)mutation
22787435 Bcr-Abl may critically requires tyrosine phosphorylation of SOCS-1 and SOCS-3 to mediate tumorigenesis when these SOCS proteins are present in cells.
22783572 Multiplex RT-PCR is a fast and reliable technique for improved detection of typical and atypical BCR/ABL transcripts.
22782217 TAT-CC fusion protein depresses the oncogenicity of BCR-ABL through interrupting its oligomerization.
22733220 tyrosine kinases of the Abl family are present in podosomes formed by murine and human macrophages.
22693568 extent and potential contribution of translational regulation to transformation and differentiation in v-Abl-transformed pre-B cells
22665066 BCR-ABL is critically involved in the leukemia-specific expression of DR4 and DR5 and in the susceptibility of Ph(+) leukemia to TRAIL-mediated anti-leukemic activity.
22632162 HIV-1 Tat-mediated inhibition of miR-196a leads to upregulation of p73 and c-ABL protein expression in cells
22593461 qPCR detected a decrease of BCR-ABL to 190 copies once, but this suddenly increased to 22,000 copies
22591684 Src, Akt, NF-kappaB, BCL-2 and c-IAP1 may be involved in an anti-apoptotic effect in patients with BCR-ABL positive and BCR-ABL negative acute lymphoblastic leukemia.
22590567 The identification of the c-Abl tyrosine kinase as a novel upstream activator of MST2 suggests that the conserved c-Abl-MST signaling cascade plays an important role in oxidative stress-induced neuronal cell death.
22526369 BCR-ABL1 transcript quantification was performed in 117 samples from chronic myeloid leukemia patients in two different laboratories by both methods, and the results were compared by statistical procedures.
22471662 Therapeutic targeting of BCR-ABL: prognostic markers of response and resistance mechanism in chronic myeloid leukaemia.
22462553 TRAIL via caspase-dependent action can sequentially activate c-Abl, p73, and stress kinases, which contribute to apoptosis in colon cancer cells.
22454521 Actin, microtubules and Abl tyrosine kinases regulate Cav1 inward trafficking.
22447844 Data show that the cyclin-dependent kinase 7/9 inhibitor (CDK7/9 inhibitor) potently inhibits FIP1L1-PDGFRalpha-positive Bcr-Abl-positive chronic myeloid leukemia (CML) cells.
22380496 poor clinical course of the case may contribute to explanation of the action of t(9;22)(q34;q11) translocation
22378042 c-Abl phosphorylated H. pylori EPIYA-A, EPIYA-B, EPIYA-C, and EPIYA-D.
22334513 results support the concept of early Abl recruitment by both the ATM and the DNAPK pathways to regulate nuclear events triggered by DNA damage and potentially communicate them to proteins in the cytoplasm
22327338 the negative loop on p38 is mediated by c-ABL phosphorylation at tyrosine 105 of the adaptor protein NCK1, while the phosphorylation at tyrosine 209 of GRB2 down-modulates ERK1/2 and JNKs signaling.
22327125 Report use of bcr-abl-transformed mouse 12B1 cells secreting interleukin-2 and granulocyte-macrophage colony-stimulating factor as cancer vaccines.
22314255 several known and novel BCR-ABL kinase domain (KD) mutations were discovered in the tyrosine kinase inhibitor-naive and -exposed Southeast Asian chronic myeloid leukemia patients, supporting the concept that naturally occurring KD mutations were present in leukemic cells prior to drug exposure
22311485 The expression of BCR/ABL fusion gene was significantly lower compared with that of the control ( DeltaCt = 4.23 +/- 0.21, P < 0.05).
22252550 ABL1 regulates spindle orientation in adherent cells and mammalian skin
22238610 c-Abl facilitates chromatin association of PCNA and is required for nuclear foci formation of PCNA in cells stressed by DNA damage as well as in unperturbed cells.
22233112 BCR-ABL activity measured by 50% inhibitory concentration for imatinib, p-CrkL/CrkL ratio or p-CrkL ratio in CD34+ cells of patients with chronic myeloid leukemia does not predict treatment response
22231445 The results demonstrate a critical contribution of STAP-2 in BCR-ABL activity.
22184410 Data suggest that chronic myeloid leukemia stem cell survival is Bcr-Abl kinase independent and suggest curative approaches in CML must focus on kinase-independent mechanisms of resistance.
22140458 The fitness changes (i.e., changes in net reproductive rate) conferred by BCR-ABL kinase domain mutations to the likelihood, composition, and diversity of pre-existing resistance, was investigated.
22089930 The ABL-inhibitors activate MAPKs in CD34+ chronic myelogenous leukemia progenitor cells.
22054731 BCR-ABL mutations in chronic myeloid leukemia [review]
22038725 we concluded that BCR-ABL splice variants, exon 7 deletion is a common splice variant not associating with imatinib resistance.
22014333 The phosphorylation and dephosphorylation cycle of VASP by the Abi-1-bridged mechanism regulates association of VASP with focal adhesions, which may regulate adhesion of Bcr-Abl-transformed leukaemic cells.
22001646 Expression of nuclear-targeted c-Abl drastically increases the levels of chromatin structural changes.
21998569 mechanisms of allosteric activation may have universally evolved in the ABL and EGFR regulatory complexes as a product of a functional cross-talk between the organizing alphaF-helix and conformationally adaptive alphaI-helix and alphaC-helix
21961412 ABL mutation occurrence can help in finding the cause of resistance to Tyrosine Kinase Inhibitors therapy in some patients suffering from Chronic Myeloid Leukemia.
21960589 In childhood Ph(+) acute lymphoblastic leukemia, BCR-ABL1 gene fusion can be a prenatal and possibly initiating genetic event.
21935931 Bcr-Abl stimulates Jab1 expression via the cooperative interaction of beta-catenin and STAT1 in leukemia cells.
21903771 Patients treated with imatinib exhibit a biphasic decrease in BCR-ABL transcript levels, with a rapid decrease during the first few months of treatment, followed by a more gradual decrease that often continues over many years.
21900237 CDK1-mediated phosphorylation of Abi1 attenuates Bcr-Abl-induced F-actin assembly and tyrosine phosphorylation of WAVE complex during mitosis
21892207 c-Abl and Arg not only promote in vitro processes important for melanoma progression, but also promote metastasis in vivo
21888027 16 point mutations of the kinase domain were found in tyrosine-kinase-inhibitor-resistant CML patients. M244V, T315I & A380V, were the most frequent
21781306 DNA damage-induced K921 Abl acetylation, mediated by Tip60, stimulates transcriptional-independent apoptotic activity and chromatin-associative property.
21764785 (18)F-SKI696 is taken up in vivo by tumors that overexpress Bcr-Abl
21694468 Data show that plasma cTK activity was closely correlated with cellular BCR-ABL1 kinase activation.
21693657 results indicate that loss of the normal ABL1 kinase may serve as a key prognostic factor that exerts major impact on CML treatment outcomes
21674858 In 100 patients (73.5%) the b3a2 and in 34 (25%) the b2a2 forms of BCR-ABL were detected
21641753 TAT-CC-HA could interact with BCR-ABL in K562 cells
21591355 The most common point mutations detected and associated with drug resistance to tyrosine kinase inhibitor therapy in chronic myeloid leukemia, were T3151 and M244V.
21527514 p90RSK2 is dispensable for BCR-ABL-induced myeloid leukemia, but may be required for pathogenesis and lineage determination in FLT3-internal tandem duplication-induced hematopoietic transformation.
21504383 Data suggest that IM-associated cytopenias are associated with a high pre-IM percentage of BCR-ABL+ cells measured by FISH, are reversible, and do not adversely affect outcomes.
21480391 Results suggest that co-targeting c-ABL and ERalpha as a combinatory approach may have therapeutic potential for breast cancer.
21461967 Both 5'ABL and 3'BCR deletions were associated with cytogenetic response failure in chronic myeloid leukemia patients treated with hydroxyurea.
21455220 c-Abl interconnecting Met-RTK and p53 core pathways, and its inhibition impairs Met-dependent tumorigenesis. Met ensures cell survival through a new path in which c-Abl and p38-MAPK are employed to elicit p53 phosphorylation and Mdm2 upregulation.
21454413 transformation from gastritis to MALT lymphoma is epigenetically regulated by miR-203 promoter methylation; ABL1 is a novel target for the treatment of this malignancy
21435002 Screening for ABL1 chimeric genes could be performed in patients with ALL, more particularly in those with T-cell ALL because ABL1 modulates T-cell development and plays a role in cytoskeletal remodeling processes in T cells.
21388681 Fusion of ABL1 with SFPQ, a pre-mRNA processing gene, is recurrent in acute lymphoblastic leukemias.
21368377 Expression of active c-Abl transgene in forebrain neurons results in severe neurodegeneration, particularly in the CA1 pyramidal cell region of the hippocampus.
21321929 these results demonstrate that in SSc fibroblasts, c-Abl is an upstream regulator of the profibrotic PKCdelta/phospho-Fli-1 pathway, via induction of PKCdelta nuclear localization.
21320496 Data show that disruption of phosphorylation sits Y398 and Y213 significantly weakens the binding of Abi-1 to c-Abl.
21266020 loss of the C-terminus of BCR-ABL1 is associated with significant resistance to kinase inhibitors
21239056 BCR-ABL1 mutations in patients with imatinib-resistant Philadelphia chromosome-positive leukemia.
21221851 We conclude that Abl kinase domain point mutations represent a major mechanism of imatinib resistance
21220745 the mechanism involved in c-Abl regulation of Mcl-1 expression in CLL cells
21203397 there is a disruption of the FA/BRCA pathway in BCR/ABL cells
21183952 Bcr-Abl stability and oncogenic signaling in chronic myeloid leukemia (CML) cells are under the control of Jak2.
21156844 Allogeneic hematopoietic stem cell transplantation for chronic myelogenous leukemia patients who failed tyrosine kinase inhibitors after developing BCR-ABL1 kinase domain mutations.
21129254 Gemcitabine has no significant effect on expression of bcr/abl mRNA in bone marrow cells from chronic myeloid leukemia patients at chronic or blastic phases.
21072043 Grb2 knockdown significantly inhibits proliferation and survival of BCR-ABL-expressing CD34+ cells, but not control CD34+ cells
21071472 FTY720-induced human pulmonary endothelial barrier enhancement is mediated by c-Abl
21045136 Bcr-abl(delexon7) is frequently observed in CML patients when using sensitive techniques. It seems to be the result of an alternative splicing mechanism and to be independent from the occurrence of resistance.
20974687 BCR-ABL promotes mutagenic DSB repair with the DSB end-processing protein CtIP acting as the key mediator downstream of BCR-ABL
20937825 Abl kinase signaling plays a critical role in invadopodia formation and function
20863169 Physical exercise induced significant increases in BCR-ABL1 transcript levels concomitant with changes in leukocyte content of peripheral blood.
20861316 Studies indicate an essential role for Abl kinase in vascular barrier regulation via posttranslational modification of nmMLCK.
20823226 tyrosine phosphorylation of parkin by c-Abl is a major posttranslational modification that inhibits parkin function, possibly contributing to pathogenesis of sporadic Parkinson's disease
20724541 Introduction of BCR-ABL and BMI1 in human cord blood CD34+ cells induces lymphoid leukemia upon transplantation in NOD/SCID mice.
20717963 Results suggest that Bcr-Abl increases Emi1 phosphorylation and stability to prevent Skp2 protein degradation via APC/Cdh1-induced ubiquitination and to enhance proliferation of CML cells.
20697894 ABL mutations are common in Chinese imatinib-resistant CML patients and are associated with clinical resistance.
20697894 Observational study of gene-disease association. (HuGE Navigator)
20697350 modular and phosphorylation-driven interaction network provides a framework for the integration of pleiotropic signaling effects of BCR-ABL1 toward leukemic transformation
20633771 this is the first report of BCR-ABL1 transcript with breakpoint occurring within both BCR and ABL1 introns and fusion of intronic sequences from both BCR and ABL1 genes
20629032 The current data pointed toward a role for c-Abl in the biology of malignant rhabdoid tumors
20598684 Macropinocytosis is regulated by interactions between Abi1 pY213 and the C-terminal SH2 domain of p85-thereby linking Abl kinase signaling to p85-dependent regulation of macropinocytosis.
20595523 study reports on less common kinase domain mutations in kinase inhibitor-resistant chronic myelogenous leukemia and Ph+ acute lymphoblastic leukemia and suggests reasons for their rarity
20585556 HIV-1 Tat-mediated inhibition of miR-196a leads to upregulation of p73 and c-ABL protein expression in cells
20585028 c-Abl is the kinase responsible for high NaCl-induced phosphorylation of TonEBP/OREBP-Y143
20581864 C3G as a novel target of c-Abl
20563669 These findings provide evidence that c-Abl participates in modulating Pitx1 expression in the apoptotic response to DNA damage.
20512393 Observational study of genetic testing. (HuGE Navigator)
20482842 pristimerin is effective against chronic myelogenous leukemia via mechanisms that may involve inhibition of NF-kappaB and Bcr-Abl
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452982 elevated Src family kinase activity is sufficient to induce imatinib resistance through a mechanism that may involve phosphorylation of Bcr-Abl
20425353 BCR/ABL kinase displays constitutive kinase activity causing deregulated proliferation, apoptosis, differentiation, & adhesion, mutator phenotype, & ROS generation. Review.
20367437 Data show that regular monitoring for the presence of point mutations in the ABL kinase region may identify such patients early, with an opportunity to intervene.
20234815 Overexpression of c-ABL proto-oncogene is associated with enhanced resistance to tamoxifen in breast cancer.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20152788 Inhibitors of the Abl kinase directed at either the ATP- or myristate-binding site.
20124512 Endogenous c-Abl mediates endothelial apoptosis induced by inhibition of integrins alphavbeta3/alphavbeta5 or by LatB-induced disruption of F-actin.
20082857 it is plausible that ABL1 deletion without BCR/ABL1 rearrangement is a rare but recurrent genetic abnormality in precursor B-ALL patients
20079431 The results show that Bcr-Abl regulates the actin cytoskeleton and non-apoptotic membrane blebbing via a GADS/Slp-76/Nck1 adaptor protein pathway.
20073070 Review of ABL1 fusion genes identified in T-cell acute lymphoblastic leukemia that provide proliferation and survival advantage to lymphoblasts.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20038234 Studiies indicate that KD mutations conferring high-level imatinib resistance are present in patients with de novo CML and in some of them lead to disease progression.
20010464 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20007699 Study suggests important roles of BCR-ABL gene expression and its native chromosomal locus for acquisition of BCR-ABL mutations and provides a new tool for further studying resistance mechanisms.
19968720 The BCR-ABL1 RQ-PCR monitoring of CML patients after ASCT with PB is concordant with BM in 95.3% of cases, and thus may be used to monitor the disease.
19954044 The majority of the adults with Ph+ ALL are p190 positive, and patients with p210 have older age, higher blood platelet count, and more frequent occurrence of splenomegaly.
19914245 c-Abl modulates innate immune response through MAVS.
19906645 a new dual binding mechanism is proposed that provides a better description of proline-rich ligand recognition by Abl-SH3 and that has important implications for rational design
19897486 Activation of c-Abl-PKCdelta signaling pathway is critically required for the claudin-1-induced acquisition of the malignant phenotype.
19876398 reciprocal ABL/BCR fusion proteins as second oncogenes encoded by the t(9;22) in addition to BCR/ABL
19833721 These results suggest that hyperoxia induces caveolin-1-dependent, c-Abl-mediated dynamin 2 phosphorylation required for recruitment of p47(phox) to caveolin-enriched microdomains and subsequent ROS production in lung endothelium.
19829692 IL-3 and oncogenic Abl regulate the myeloblast transcriptome by altering mRNA stability
19789182 These findings suggest roles for emerin as a downstream effector and signal integrator for tyrosine kinase signaling pathway(s) at the nuclear envelope.
19768693 Among 55 imatinib-resistant CML patients treated with dastinib or nilotinib, baseline mutations in the kinase domain disappeared in 8 patients & new mutations appeared in 9. T315I was the most frequently detected mutation.
19738611 Observational study of gene-disease association. (HuGE Navigator)
19724931 Report DNA vaccination against bcr-abl-positive cells in mice.
19700222 Activation of transgenic c-Abl by amyloidbeta precursor protein promotes tau phosphorylation through Tyr15 phosphorylation-mediated cyclin-dependent protein kinase 5 (Cdk5) activation.
19697154 BCR/ABL switch on backup non-homologous end joining (B-NHEJ) which is more error-prone thann DNA-PK(CS) D-NHEJ and in such manner contribute to the increase of the genomic instability of leukemic cells.
19679652 N-myristoylated c-Abl tyrosine kinase localizes to the endoplasmic reticulum upon binding to an allosteric inhibitor
19660459 Results describe the conformational changes that accompany the binding of Gleevec, or imatinib mesylate, to the tyrosine kinases c-Kit and c-Abl.
19658100 ZNF198-FGFR1 is associated with phosphorylation of several proteins including SSBP2, ABL, FLJ14235, CALM and TRIM4 proteins.
19657362 BCR/ABL fragments were used for identifying the sites of BCR/ABL interaction with RAD51B
19652056 Impact of baseline BCR-ABL mutations on response to nilotinib in patients with chronic myeloid leukemia in chronic phase.
19643477 the additive effects of imatinib and Everolimus on BCR-ABL-expressing cells are at least partly conditional upon the enhanced nuclear accumulation of p145 c-ABL
19625707 BCR-abl transcript rise cutoffs of 5-fold or greater had poor diagnostic sensitivity and no significant association with mutations.
19608682 Data show that the the BCR-ABL fusion protein is captured and detected by a cytometric bead assay and analyzed by flow cytometry
19571320 BCR-ABL promotes the frequency of mutagenic single-strand annealing DNA repair
19557636 analysis of exon 6 bcr-abl mutations in patients with chronic myeloid leukemia treated with tyrosine kinase inhibitors
19542604 Mounting evidence summarized in this review suggests that tyrosine kinase c-Abl and Fyn are critical in the neurodegenerative process which occurs in tauopathies.
19442657 this study implicates a role for hMSH5 in DNA damage response involving c-Abl and p73, and suggests that mutations impairing this process could significantly affect normal cellular responses to anti-cancer treatments.
19427856 the phosphorylation of Rad51 Tyr315 stimulates that of Tyr54, which indicates that the phosphorylation of Rad51 by the c-Abl kinase is a sequential process
19423701 c-Abl phosphorylates RACK1 at the Focal Adhesion Kinase interaction site and c-Abl kinase activity is required for interaction of Focal Adhesion Kinase with RACK1.
19383348 Expression of CD69 and IL8 is upregulated upon Bcr-Abl expression
19369965 The 'gatekeeper mutation' T315I confers additional leukemogenic activity to BCR/ABL, which might explain the clinical behavior of patients with BCR/ABL-T315I-positive blasts
19363261 These studies demonstrate altered activation and distribution of c-Abl during Alzheimer's disease, suggesting a role for c-Abl in Abeta signal transduction and generation of tau pathology in Alzheimer's disease.
19357699 BCR-ABL downregulates c-Jun expression by activating the PI3K-Akt pathway during chronic phase of chronic myeloid leukemia (CML-CP).
19332026 These data showed that BimL expression induced by BCR activation may result from the splicing of BimEL mRNA independently of Bim promoter regulation.
19295548 Bcr-Abl expression increases Nox-4-generated ROS, which in turn increases survival signaling through PI3k/Akt pathway by inhibition of PP1alpha, thus contributing to the high level of resistance to apoptosis seen in TonB.210 cells.
19285032 phosphorylation on Tyr-315 by c-ABL is required for chromatin association of oligomerization-defective RAD51 mutants, but is insufficient to restore oligomerization.
19275932 Abl kinases not only are activated by PDGFR and promote PDGFR-mediated proliferation and migration, but also act in an intricate negative feedback loop to turn-off PDGFR-mediated chemotaxis.
19261608 Bcr-Abl represses the expression of PHLPP1 and PHLPP2 and continuously activates Akt1, -2, and -3 via phosphorylation on Ser-473, resulting in the proliferation of CML cells
19260121 3 independent, resistance-inducing, missense point mutations in the BCR-ABL kinase domain arose in each of 2 CML patients during therapy with protein kinase inhibitors: G250E, F359I, V299L, E355G, T495R, & F317L.
19234221 c-Abl kinase is activated by beta2 integrin engagement and is required for beta2 integrin-dependent neutrophil sustained adhesion and spreading.
19203793 ABL mutation is associated with chronic myeloid leukemia.
19180499 PDGFRbeta and Abl play critical, synergistic roles in the pathogenesis of systemic sclerosis, and imatinib targets a gene expression program that is frequently dysregulated in this disease.
19156526 PCNA negatively regulates the stability of c-Abl and thereby inhibits apoptosis in the response to DNA damage.
19135771 early cellular and transcriptional effects of P190 BCR/ABL1 and P210 BCR/ABL1 expression are very similar when expressed in the same human progenitor cell population, and STAT5 is an important regulator of BCR/ABL1-induced erythroid cell expansion
19124506 Observational study of gene-disease association. (HuGE Navigator)
19108887 The occurrence of ABL point mutation is not associated with resistance to Imatinib Mesylate in BCR-ABL positive acute lymphoblastic leukemia
19075013 c-Abl not only targets Hdm2, but also Hdmx, which together contribute to p53 activation in response to DNA damage.
19061839 BCR-ABL inhibition is sufficient to commit chronic myeloid leukemia cells irreversibly to apoptosis
19052872 c-Abl and p53 are important for execution of the cell death program initiated in A2E-laden RPE cells exposed to blue light, while JNK might play an anti-apoptotic role
19048492 detection of Bcr/Abl transcripts in newly diagnosed chronic myelogenous leukemia cases
19020542 BCR/ABL enhances the accumulation of DSBs and alters the apoptotic threshold in CML leading to error-prone DNA repair
19016792 inhibition of EGFR endocytosis occurs via a CagA-dependent activation of the non-receptor kinase c-Abl, which in turn phosphorylates the EGFR target site pY1173.
19001122 Rap1 as another downstream target of the Abl-CrkII signaling module and show that Abl-CrkII collaborates with Rho-ROCK1 to stimulate cell retraction.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18936177 Taken together, these findings indicate that c-Abl is activated during S. enterica serovar Typhimurium infection and that its phosphorylation of multiple downstream targets is functionally important in bacterial internalization.
18827185 BCR-ABL1 plays cousal role in pathogenesis of chronic myeloid leukemia exhibiting deregulated cell proliferation, growth factor independence and reduced apoptosis resulting form signal pathways activation
18809728 Results identify a mechanism by which the WAVE2 complex regulates T cell receptor signaling to Rap1 and integrin activation via Abl- and CrkL-C3G.
18794796 Hck has a nonredundant function as a key downstream signaling partner for Bcr-Abl and may represent a potential drug target in CML
18784740 a thorough biochemical comparative analysis of NUP214-ABL1 and BCR-ABL1 show that, despite their common tyrosine kinase domain, the two fusion proteins differ in many critical catalytic properties
18775312 The SH2 and catalytic domains of active Fes and Abl pro-oncogenic kinases form integrated structures essential for effective tyrosine kinase signaling.
18771174 c-Abl and D40 interact with the tumor suppressor pRb protein and subsequently can lead to regulation of the cell proliferation.
18765637 These results demonstrate regulated tyrosine phosphorylation of AIB1/SRC-3 at a C-terminal tyrosine residue (Y1357) that is phosphorylated after insulin-like growth factor 1, epidermal growth factor, or estrogen treatment of breast cancer cells.
18704194 BCR-ABL leukemogenesis inis blocked by PI3K in mice, and a dual PI3K/mTOR inhibitor prevents expansion of human BCR-ABL+ leukemia cells
18687796 ABL kinase domain pseudoexon insertion is not uncommon in BCR-ABL transcripts.
18619508 nuclear c-Abl kinase can activate CSF-1 gene transcription by regulating AP-1 activity in the signaling events induced by L-selectin ligation.
18614052 NUP214-ABL1 fusion is unique because of its requisite localization to the nuclear pore complex for its transforming potential.
18603549 Novel point mutations should be confirmed by analyzing the normal ABL alleles to exclude polymorphisms
18603549 Observational study of gene-disease association. (HuGE Navigator)
18546844 mediates intracellular signals to regulate a variety of cellular responses and its genomic mutations and alterations underlie cancer, viral and/or bacterial infections.[review]
18538733 Expression of miR-203 reduces ABL1 and BCR-ABL1 fusion protein levels and inhibits tumor cell proliferation in an ABL1-dependent manner, suggesting it may function as a tumor suppressor.
18490454 c-Abl and Cdk5 cooperatively regulate maximal activation of p53, resulting in neuronal death in response to oxidative stress by hydrogen peroxide.
18480061 c-Abl kinase has a role in DNA mismatch repair-dependent G2 cell cycle checkpoint arrest responses
18480060 MMR-dependent intrinsic apoptosis is p53-independent, but stimulated by hMLH1/c-Abl/p73alpha/GADD45alpha retrograde signaling
18427551 c-Abl tyrosine kinase per se may be a negative regulator of growth factor signaling.
18413724 BCR/ABL kinase abrogates mismatch repair activity to inhibit apoptosis and induce mutator phenotype.
18406870 ABL1 deletions are not associated with the complexity of translocation genesis of chronic myeloid leukemia
18401414 SphK1 is a downstream effector of the Bcr-Abl/Ras/ERK pathway
18391983 activated c-Abl tyrosine kinase, not as a fusion protein, plays an important role in malignant solid tumors of lung and breast.
18369471 results demonstrate that PDGFRbeta and Abl kinases function redundantly to promote efficient uptake of Chlamydia trachomatis
18362889 pharmacological inhibition of c-Abl compromises DNA-damage response
18339898 BCR-ABL1 in malignant cells constitutively increases expression of activation-dependent epitopes of LFA-1 and complete loss of responsiveness of LFA-1 to SDF-1-induced "inside-out" signaling involving CXCR4 and Lyn, leading to aberrant adhesive responses
18305550 dynamics of ABL1 kinase mutations in BCR-ABL1
18305217 identify c-Abl as a key player in the signaling cascade, leading to actin reorganization during T-cell activation
18287094 BCR-ABL impairs host defenses and promotes malignant transformation, involving dual suppression of IFN-activated signaling pathways
18262060 novel and complex Ph-negative chronic myeloid leukemia case in which the BCR/ABL protein is located on 3p14.
18180382 Up-regulation, in contrast to activation, of the ubiquitously expressed Src kinase, Fyn, by BCR-ABL1, is described.
18161990 Phosphorylation of c-Abl by Pak2 inhibits the interaction between the SH3 domain of Abi2 and the PxxP motif of c-Abl, and the phosphorylation enhances the association of c-Abl with the substrate Crk and increases c-Abl-mediated phosphorylation of Crk.
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18089786 MUC1 stabilizes Bcr-Abl and contributes to pathogenesis of chronic myelogenous leukemia cells by promoting self renewal and the MUC1 cytoplasmic domain.
18082628 These results demonstrate that allele-specific changes in gene expression, with selective, progressive silencing of the wild-type ABL1 allele in favor of the oncogenic BCR-ABL1 allele occur in CML patients with therapy-resistant disease.
18059481 p210(BCR-ABL) is arranged in discrete foci in the cytoplasm of cell lines and primary CD34(+) cells but not mononuclear cells suggesting the foci may be a feature of immature chronic myeloid leukaemia cells.
18036399 two cases described here presented a masked t(9;22)(q34;q11.2) in association with a t(19;21); in both cases, the masked Philadelphia chromosome resulted from an insertion of ABL in 22q11, with a proven 22q deletion in one case
17972958 concurrent JAK2V617F and BCR-ABL translocation appeared to affect independent subclones
17956664 The beta-catenin gene in blast crisis of chronic myeloid leukemia patients is expressed higher than that in chronic phase and accelerated phase of CML, and its expression level is correlated with the level of bcr/abl expression.
17943163 by activating the Abi1 pathway, Bcr-Abl induces a translocation of MT1-MMP to a membrane-associated structural complex enriched with F-actin and adhesion molecules.
17925491 requirement of E2F3 for BCR/ABL leukemogenesis
17893873 p38 MAPK activation in response to cisplatin does not require the tyrosine kinase activity of c-Abl
17889935 mutations in BCR-ABL causing resistance to both Imatinib Mesylate and Dasatinib in a chronic myeloid leukaemia patient is associated with lymphoid blast crisis
17804707 Crystal structure of the T315I Abl mutant in complex with the aurora kinases inhibitor PHA-739358.
17768119 Imatinib mesylate-resistant chronic myelogenous leukemia patients harbor T315I BCR-ABL mutation
17764157 Significant percentage of the total endogenous Crk II partitions in the nucleus in mammalian cells, where it forms distinct complexes with DOCK180, Wee1, and Abl.
17762503 The incidence of BCR-ABL fusion oncogene in Pakistani patients with childhood acute lymphoid leukemia is diferent from other populations.
17761812 A role for ARF in human Philadelphia chromosome-positive lymphoblastic leukemia progression.
17710227 suggest a role for a combination of ABL kinase inhibitors, perhaps including VX-680, to prevent the outgrowth of cells harboring drug-resistant BCR-ABL mutations
17695727 c-Abl may determine cell fate via its subcellular localization [review]
17638918 BCR/ABL-Y177 plays an essential role in Ras and Akt activation and in human hematopoietic progenitor transformation in chronic myelogenous leukemia
17623672 the activation of WAVE3 to promote actin remodeling is enhanced by the c-Abl-mediated tyrosine phosphorylation of WAVE3.
17620332 c-Abl activation by insulin, via a modification of FAK response, may play an important role in directing mitogenic versus metabolic insulin receptor signaling.
17604596 These results indicate that long-term pre-treatment with Docosahexaenoic acid makes Bcr-Abl HL-60 cells more susceptible to the toxic effect of imatinib.
17599053 BCR/ABL induces SPK1 expression and increases its cellular activity, leading to upregulation of Mcl-1 in CML cells.
17597804 p210BCR-ABL oncoprotein activity is linked to centrosomal hypertrophy
17587335 Results show that by activating Abl-1 signalling pathway, Anaplasma phagocytophilum protein AnkA facilitates its intracellular infection.
17579186 T-cell repertoire of a patient with chronic myeloid leukemia in major molecular remission due to imatinib mesylate was also dominated by T cells directed against Bcr-Abl-regulated antigens
17570524 alternatively spliced transcripts lacking exon 7 in c-abl gene were associated with resistance to imatinib
17541395 CapZIP is fused to ABL1 in a t(1;9)(q24;q34)-associated B-cell acute lymphoblastic leukemia
17525531 ERF is targeted for inactivation by transforming oncogenes such as vAbl.
17486070 Oncogenic activation of c-Abl due to lack of FUS1 expressionin results in non-small cell lung cancer.
17470736 Primary and cultured chronic myeloid leukemia stem cellsdisplay instability of the BCR-ABL fusion gene both in vivo and in vitro.
17470729 Acute myelogenous leukemia patients respond to imatinib mesylate only when BCR-ABLE kinase is inhibited.
17374743 Ubp43 deficiency increases the resistance to oncogenic transformation by BCR-ABL
17366548 conclude that our patient represents another case of the rare hematological entity characterized by an ETV6-ABL translocation
17349636 The expression of Bcr-Abl leads to hyper-responsiveness of myeloid cells to TGFbeta; this novel cross-regulatory mechanism might play an important role in maintaining the transformed progenitor cell population in CML.
17347407 Bcr-Abl overexpression results in increased proliferation and antiapoptotic signaling in CD34(+) cells, but may not play a direct role in imatinib resistance in progenitor cells expressing either wild-type or mutant BCR/ABL genes.
17339230 overexpression of c-Abl tyrosine kinase activated p21 promoter and endogenous p21 transcription in U2OS cells.
17303698 BCR-ABL mutations confer resistance to the Abl kinase inhibitor AMN107 (nilotinib) in chronic myeloid leukemia
17268511 Fusion transcription in 16 year old girl with chronic myeloid leukemia.
17252009 BCR-ABL-kinase domain mutations in patients with a stable CCR are infrequent, and their detection does not consistently predict relapse. Alternative mechanisms must be responsible for disease persistence in the majority of patients.
17237826 The interaction between c-Cbl and SLAP in v-Abl-3T3 cells positively influenced c-Cbl-mediated spreading and adhesion of these cells
17196995 a system akin to the BCR-ABL translocation of CML may be involved in genomic instability in about one-third of colorectal carcinomas
17160020 Upon H. pylori infection c-Abl directly interacts with CagA and localizes in focal adhesion complexes and membrane ruffles, which are highly dynamic cytoskeletal structures necessary for cell motility
17126298 These results suggest an important role of tyrosine 311 in the apoptotic function of PKCdelta and implicate c-Abl as the kinase that phosphorylates this tyrosine.
17101133 NESH (Abi-3), like Abi-1 and Abi-2, is a component of the Abi/WAVE complex, but likely plays a different role in the regulation of c-Abl.
16998483 BCR-ABL-expressing leukemic stem cells depend to a greater extent on CD44 for homing and engraftment than do normal hematopoietic stem cells
16966279 retention of a dephosphorylated p210Bcr-Abl has a biologic impact distinct from that of downregulation/loss of p210Bcr-Abl and, in a subset of patients, loss of the target of the kinase inhibitor may lead to imatinib mesylate resistance
16912036 the Bcr-Abl SH3-SH2 region is phosphorylated by Src family kinases, which modulate Bcr-Abl transforming activity
16899465 c-Abl activates WAVE2 via tyrosine phosphorylation to promote actin remodeling in vivo; Abi-1 forms the crucial link between these two factors
16867995 c-Abl represents a target downstream of phosphatidylinositol 3-kinase-activated PAK2, which differentiates TGF-beta signaling in fibroblasts and epithelial cell lines.
16678104 The present study demonstrates that c-Abl and Arg (abl-related gene) tyrosine kinases associate with and phosphorylate the proteasome PSMA7 (alpha4) subunit at Tyr-153.
16636310 Data show that nuclear accumulations of p53 and Mdm2 are accompanied by reductions in c-Abl and p300 in zinc-depleted human hepatoblastoma cells.
16630659 The results could be considered as an evidence of an actual biological phenomenon that could provide additional information about the Fusion Proteins, bcr-abl and HOXA9 role in the CML progression.
16543148 Small-angle X-ray scattering (SAXS) analysis shows that a mutated form of c-Abl, in which the N-terminal cap and two other key contacts in the autoinhibited state are deleted, exists in an extended array of the SH3, SH2, and kinase domains.
16448696 The choronic myeloid leukemia(CML) derived MSCs did not express BCR/ABL gene and Ph chromosome, and had not the ability to development tumor in nude mice. At last, they could express hematopoietic cytokines, and possessed hematopoietic supportive ability.
16410245 activation of the c-Abl-PKCdelta-Rac1-p38 MAPK pathway in response to ionizing radiation signals conformational changes of Bak and Bax, resulting in mitochondrial activation-mediated apoptotic cell death in human non-small cell lung cancer cells
16386788 The TCR gene rearrangements in childhood B-lineage acute lymphoblastic leukemia was associated with expression of bcr/abl chimeric oncogene.
16205638 BCR-ABL1 induces aberrant splicing of IKAROS, which interferes with lineage identity and differentiation of pre-B lymphoblastic leukemia cells.
16158059 A mechanism for how Crk-II functions in the transactivation of the Abl tyrosine kinase.
16151465 Observational study of gene-disease association. (HuGE Navigator)
16091742 c-Abl promotes the induction of EGR1 through the MEK/ERK pathway in regulating apoptotic response to oxidative stress.
16014719 Tyr-394 is the main residue for Abl phosphorylation of tau. Abl is seen in pretangle brain neurons from Alzheimer cases. phosphorylation of tau on Tyr-394 is is potentially part of a signal relay. Abl could have a pathogenic role in Alzheimer's disease.
15961388 TopBP1 is a c-Abl-interacting protein and a repressor for c-Abl expression
15857938 ability of Bcr-Abl to stimulate the expression of osteopontin
15735728 Bcr-Abl-induced abnormalities in glucose transport regulation have roles in chronic myeloid leukaemia
15723338 Along with BCR, deleted in leukemia, myeloid, philadelphia-positive.
15716990 the incidence of deletions from the der(9) in childhood acute lymphoblastic leukemia is at least as high as that reported for chronic myeloid leukemia.
15696159 JNK phosphorylates 14-3-3 proteins, which regulate nuclear targeting of c-Abl in the apoptotic response to DNA damage
15686624 c-Abl has a role in the DNA-damage stress response and in cell physiology (review)
15661746 the promoter specificity plays an important role in selective activation of p53 DNA binding by c-Abl
15657136 Abi-1-mediated coupling of Abl to WAVE2 promotes Abl-evoked WAVE2 tyrosine phosphorylation required to link WAVE2 with activated Rac and with actin polymerization and remodeling at the cell periphery.
15657060 caspase-9 autoprocessing is regulated by c-Abl in the apoptotic response to genotoxic stress.
15626746 MCL-1 is a BCR/ABL-dependent survival factor and interesting target in chronic myeloid leukemia.
15608616 the ability to regulate the cellular abundance of mitogen-activated protein kinase 7 contributes to the oncogenic potential of Abl kinases
15591787 Abi enhances Abl-mediated downregulation and phosphorylation of Cdc2 kinase
15583852 Abl is a prototype of oncogenic fusion proteins in chronic myeloid leukemia [review]
15542838 Bcr-Abl mediates protection from apoptosis downstream of mitochondrial cytochrome c release
15481444 FISH analysis of the abl and bcr genes showed the signal for bcr/abl fusion on the der(22) chromosome but not on the der(9) chromosome in Philadelpha-Negative chronic myeloid leukemia.
15361874 NUP214-ABL1 expression defines a new subgroup of individuals with T-ALL
14993251 BCR-ABL1 kinase activity is linked to defective pre-B cell receptor signaling
14966468 bcr-abl transcript can be detected in the PBLs of Philadelphia chromosome (Ph)-negative essential thrombocythemia but the level of expression is markedly less than that in CML
14745431 results confirm the high frequency of BCR-ABL kinase domain mutations in patients with secondary resistance to imatinib and exclude mutations of the activation loops of KIT, PDGFRA and PDGFRB as causes of resistance in patients without ABL mutations
14670960 Bcr-Abl-mediated transformation involves transcriptional activation of the PKCiota gene, which in turn is required for Bcr-Abl-mediated chemoresistance
14657955 Describe RT-PCR/capillary electrophoresis method for quantification of bcr-abl transcripts in leukemia.
14581377 down-regulation of Bcr-Abl mRNA might be one of the mechanisms implicated in the apicidin-mediated apoptosis in the K562 cells
14534537 ABL fuses with BCR to form a fusion protein.
14527680 the equilibrium fraction of c-Abl in which the myristoylated N-terminal is unlatched is approximately 0.5%
12952226 The deletion of the 5'abl region on der(9), present in approximately 9% of the CML, takes place at the same time as the formation of the Ph chromosome translocation and seems of worse prognosis
12950161 findings indicate that, in addition to stimulating catalase activity, c-Abl and Arg promote catalase degradation in the oxidative stress response
12944467 we have identified a direct binding between WRN and c-Abl in vitro via the N-terminal and central regions of WRN and the Src homology domain 3 of c-Abl. These findings suggest a novel signaling pathway
12928501 differential utilization of the p53 and c-Abl/p73 pathways by different tumor cell line.
12921956 ABL-kinase domain point mutation as a cause of imatinib resistance in CML patient who progress to myeloid blast crisis
12890867 Expression of BCR/ABL and BCL-2 in myeloid progenitors leads to myeloid leukemias.
12824179 c-Abl tyrosine kinase selectively regulates p73 nuclear matrix association
12810679 c-Abl increases the cellular p73 abundance through posttranslational regulation. Kinase activity is essential for c-Abl to up-regulate p73. c-Abl contributes to either pro- or antiapoptotic process depending on the expression profile of p73 isoforms.
12781448 BCR/ABL amplification may play a role as a novel mechanism in the progression to an aggressive blast transformation in some cases of Philadelphia chromosome-positive chronic myelocytic leukemia
12777400 c-Abl and Arg regulate catalase and that this signaling pathway is of importance to apoptosis in the oxidative stress response
12777393 Dok-R and c-Abl interact in both a constitutive and inducible fashion and Dok-R influences the intracellular kinase and biological activity of c-Abl
12764153 BCR-ABL is inhibited by lyp tyrosine phosphatase
12672821 c-Abl-mediated phosphorylation of Mena is regulated by Abi-1
12665579 mechanism by which caspases can recruit c-Abl to the nuclear compartment and to the mammalian apoptotic program
12654250 This gene is regulated by a myristoyl/phosphotyrosine switch.
12650908 In conclusion, effective and prompt IR-induced Rad51 focus formation is cell cycle-regulated and requires both ATM and c-Abl.
12623848 detection of kinase domain mutations was almost always associated with imatinib resistance, and patients with mutations in the P-loop had a particularly poor prognosis
12560071 concluded that the IRS-1 protein is involved in the signalling pathway of the BCR-ABL tyrosine kinase
12556557 constitutively activated Bcr-Abl kinase pathways in primitive CML progenitors cooperate with growth factors producing a growth response and disrupt the normally required synergistic interactions between kit ligand and other cytokines to achieve activation
12525554 An inherited, apparently balanced translocation involving chromosomes 3(q22), 22(q12), and 9(q34.1, resulting from meiotic recombination, leads to deletion in the ABL gene in a child with axial hypotonia and dysmorphism. )
12505259 Chronic myelocytic leukemia with eosinophilia, t(9;12)(q34;p13), and ETV6-ABL gene rearrangement: case report and review of the literature.
12408765 expression of bcr/abl hybridized gene in chronic myeloid leukemia (CML), acute lymphatic leukemia (ALL) and polycythemia vera (PV), and its clinical significance
12393636 point mutations in Abl that rendered Bcr-Abl imatinib mesylate-resistant, including a mutation that destabilized the inactive conformation of Abl suggesting that the inhibitor required inactivation of the kinase prior to binding.
12384576 determined the NMR solution structure of the ternary complex of the Abl SH3 domain with the Crk SH2 domain bound to a Crk pY221 phosphopeptide
12374288 Review. ABL protein tyrosine kinases regulate cell proliferation, survival, adhesion, migration, stress responses, and cytoskeletal dynamics.
12220663 The data showed that c-abl expression is differently modified in lymphoid B cell lines.
12149456 mutations of Tyr-253 in the nucleotide-binding (P) loop of the Abl kinase domain to Phe or His in patients with advanced CML and acquired STI-571 resistance
12144533 chronic myelogenous leukemia characterized by translocation between chromosomes 9 and 22 forming a BCR-ABL gene, a specific marker for this disease.
12138893 This review focuses on how Bcr-Abl affects HSCs and how Bcr-Abl expression alters the properties of HSCs.
12130516 Several types of mutations of the Abl gene can be found in chronic myeloid leukemia patients resistant to STI571, and they can pre-exist to the onset of treatment.
12024016 C terminus of BRCA1 is phosphorylated by c-Abl in vitro (PROTO-ONCOGENE C-ABL)
11971963 These findings indicate that Rad9 is regulated by a c-Abl-dependent mechanism in the apoptotic response to genotoxic stress. (c-abl protein)
11840343 regulates p73 through p38 MAP kinase pathway
11780146 crystal structure of the Bcr-Abl oncoprotein oligomerization domain
11708318 The abl protein was analyzed by real time quantitative PCR.

AA Sequence

MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALY      1 - 70
DFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYL     71 - 140
LSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLI    141 - 210
TTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEV    211 - 280
EEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSA    281 - 350
MEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS    351 - 420
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIH    421 - 490
QAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESD    491 - 560
PLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPER    561 - 630
RGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLAT    631 - 700
GEEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGEN    701 - 770
RSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS    771 - 840
ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKA    841 - 910
GGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAP    911 - 980
VPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQM    981 - 1050
ASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSS   1051 - 1120
VKEISDIVQR                                                               1121 - 1130
//

Text Mined References (662)

PMID Year Title
27273956 Correlation of p210 BCR-ABL transcript variants with clinical, parameters and disease outcome in 45 chronic myeloid leukemia patients.
27018250 2016 Functional interaction between nonreceptor tyrosine kinase c-Abl and SR-Rich protein RBM39.
26838548 2016 ABL kinases promote breast cancer osteolytic metastasis by modulating tumor-bone interactions through TAZ and STAT5 signaling.
26831735 2016 Secretion of IL-1? from imatinib-resistant chronic myeloid leukemia cells contributes to BCR-ABL mutation-independent imatinib resistance.
26721204 2016 Blockade of the interaction between Bcr-Abl and PTB1B by small molecule SBF-1 to overcome imatinib-resistance of chronic myeloid leukemia cells.
26607903 2016 Perturbation of energy metabolism by fatty-acid derivative AIC-47 and imatinib in BCR-ABL-harboring leukemic cells.
26429164 2015 c-abl and YWHAZ gene expression in gastric cancer.
26429162 2015 Real-time quantitative PCR detection of WT1 and M-BCR-ABL expressions in chronic myeloid leukemia.
26295305 2015 Non genomic loss of function of tumor suppressors in CML: BCR-ABL promotes I?B? mediated p53 nuclear exclusion.
26291129 2015 MAPK15 mediates BCR-ABL1-induced autophagy and regulates oncogene-dependent cell proliferation and tumor formation.
26252834 2015 Molecular characterization and follow-up of five CML patients with new BCR-ABL1 fusion transcripts.
26217035 2015 c-Abl-mediated tyrosine phosphorylation of JunB is required for Adriamycin-induced expression of p21.
26203192 2015 Hepatitis C Virus Particle Assembly Involves Phosphorylation of NS5A by the c-Abl Tyrosine Kinase.
26186983 Cytogenetic, fluorescence in situ hybridization, and genomic array characterization of chronic myeloid leukemia with cryptic BCR-ABL1 fusions.
26179066 2015 BCR/ABL1 and BCR are under the transcriptional control of the MYC oncogene.
26152360 2015 Deleterious c-Cbl Exon Skipping Contributes to Human Glioma.
26126715 2015 The kinase ABL phosphorylates the microprocessor subunit DGCR8 to stimulate primary microRNA processing in response to DNA damage.
26087013 2015 Clonal Evolution and Blast Crisis Correlate with Enhanced Proteolytic Activity of Separase in BCR-ABL b3a2 Fusion Type CML under Imatinib Therapy.
26072332 2015 Expression of the ETS transcription factor GABP? is positively correlated to the BCR-ABL1/ABL1 ratio in CML patients and affects imatinib sensitivity in vitro.
25999467 2015 Tyrosine phosphorylation of RAS by ABL allosterically enhances effector binding.
25997600 2015 Dissecting the role of aberrant DNA methylation in human leukaemia.
25944899 2015 The Tyrosine Kinase c-Abl Promotes Homeodomain-interacting Protein Kinase 2 (HIPK2) Accumulation and Activation in Response to DNA Damage.
25911675 2015 FGF8, c-Abl and p300 participate in a pathway that controls stability and function of the ?Np63? protein.
25883211 2015 Combined inhibition of EGFR and c-ABL suppresses the growth of triple-negative breast cancer growth through inhibition of HOTAIR.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25795725 2015 c-Abl mediated tyrosine phosphorylation of paxillin regulates LPS-induced endothelial dysfunction and lung injury.
25769542 2015 Expression profiling of adult acute lymphoblastic leukemia identifies a BCR-ABL1-like subgroup characterized by high non-response and relapse rates.
25756742 2015 Switching to second-generation tyrosine kinase inhibitor improves the response and outcome of frontline imatinib-treated patients with chronic myeloid leukemia with more than 10% of BCR-ABL/ABL ratio at 3 months.
25740611 2015 Incidence and clinical importance of BCR-ABL1 mutations in Iranian patients with chronic myeloid leukemia on imatinib.
25730044 2015 Quantitative real-time polymerase chain reaction as an efficient molecular tool for detecting minimal residual disease in Moroccan chronic myeloid leukemia patients.
25648025 2014 Status of leptin in MBCR-ABL p210 positive chronic myeloid leukemia patients before and after imatinib therapy: a conflicting scenario.
25644089 2015 Anti-cancer fatty-acid derivative induces autophagic cell death through modulation of PKM isoform expression profile mediated by bcr-abl in chronic myeloid leukemia.
25620702 2015 c-Abl regulates proteasome abundance by controlling the ubiquitin-proteasomal degradation of PSMA7 subunit.
25615000 2015 Emergence of BCR-ABL kinase domain mutations associated with newly diagnosed chronic myeloid leukemia: a meta-analysis of clinical trials of tyrosine kinase inhibitors.
25561363 2015 c-Abl induces stabilization of histone deacetylase 1 (HDAC1) in a kinase activity-dependent manner.
25527259 2015 Attenuation of fibrosis with selective inhibition of c-Abl by siRNA in systemic sclerosis dermal fibroblasts.
25418123 2015 Potent inhibition of TGF-? signaling pathway regulator Abl: potential therapeutics for hepatic fibrosis.
25368164 2014 c-Abl tyrosine kinase promotes adipocyte differentiation by targeting PPAR-gamma 2.
25293778 2014 BCR-ABL1 promotes leukemia by converting p27 into a cytoplasmic oncoprotein.
25248240 2014 [Atypical BCR-ABL transcripts in patients with chronic myeloid leukemia--the scheme for the diagnosis and monitoring of minimal residual disease].
25233427 2014 Neuropilin-1 enforces extracellular matrix signalling via ABL1 to promote angiogenesis.
25219501 2014 c-Abl stabilizes HDAC2 levels by tyrosine phosphorylation repressing neuronal gene expression in Alzheimer's disease.
25213664 2014 The malignancy suppression role of miR-23a by targeting the BCR/ABL oncogene in chromic myeloid leukemia.
25134459 2015 Combined STAT3 and BCR-ABL1 inhibition induces synthetic lethality in therapy-resistant chronic myeloid leukemia.
25132497 2014 BCR-ABL1 compound mutations combining key kinase domain positions confer clinical resistance to ponatinib in Ph chromosome-positive leukemia.
25074247 2014 ABL1 gene involvement within a complex three-way translocation (2;9;4) in perineurioma characterized by molecular cytogenetic methods.
25068103 2014 Identification of a novel SEPT9-ABL1 fusion gene in a patient with T-cell prolymphocytic leukemia.
25052580 2014 Avian influenza viruses inhibit the major cellular signalling integrator c-Abl.
25045550 2014 Complex variant of Philadelphia translocation involving chromosomes 9, 12, and 22 in a case with chronic myeloid leukaemia.
25036192 2015 A certified plasmid reference material for the standardisation of BCR-ABL1 mRNA quantification by real-time quantitative PCR.
24967705 2014 ATRA-induced cellular differentiation and CD38 expression inhibits acquisition of BCR-ABL mutations for CML acquired resistance.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24939418 2014 Arsenic trioxide and bortezomib interact synergistically to induce apoptosis in chronic myelogenous leukemia cells resistant to imatinib mesylate through Bcr/Abl?dependent mechanisms.
24903628 2014 Cell sorting enables interphase fluorescence in situ hybridization detection of low BCR-ABL1 producing stem cells in chronic myeloid leukaemia patients beyond deep molecular remission.
24891505 2014 Two amino acid residues confer different binding affinities of Abelson family kinase SRC homology 2 domains for phosphorylated cortactin.
24856998 2014 [Clinical characteristics of childhood leukemia with EVI1 gene and BCR/ABL gene co-expression].
24837466 2014 Distinct characteristics of e13a2 versus e14a2 BCR-ABL1 driven chronic myeloid leukemia under first-line therapy with imatinib.
24836440 2014 BCR-ABL affects STAT5A and STAT5B differentially.
24779036 2014 Involvement of primary mesenchymal precursors and hematopoietic bone marrow cells from chronic myeloid leukemia patients by BCR-ABL1 fusion gene.
24775308 2014 Combination of the ABL kinase inhibitor imatinib with the Janus kinase 2 inhibitor TG101348 for targeting residual BCR-ABL-positive cells.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24700464 2014 The association of cortactin with profilin-1 is critical for smooth muscle contraction.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24617663 2014 Monocyte-derived dendritic cells from chronic myeloid leukaemia have abnormal maturation and cytoskeletal function that is associated with defective localisation and signalling by normal ABL1 protein.
24550512 2014 Molecular dynamics reveal BCR-ABL1 polymutants as a unique mechanism of resistance to PAN-BCR-ABL1 kinase inhibitor therapy.
24522549 2014 Oxidative stress-induced signaling pathways implicated in the pathogenesis of Parkinson's disease.
24520051 2014 Abelson phosphorylation of CLASP2 modulates its association with microtubules and actin.
24487968 2014 Curcumin derivative C817 inhibits proliferation of imatinib-resistant chronic myeloid leukemia cells with wild-type or mutant Bcr-Abl in vitro.
24456693 2014 BCR-ABL kinase domain mutations, including 2 novel mutations in imatinib resistant Malaysian chronic myeloid leukemia patients-Frequency and clinical outcome.
24421390 2014 The capable ABL: what is its biological function?
24412932 2014 c-Abl phosphorylates ?-synuclein and regulates its degradation: implication for ?-synuclein clearance and contribution to the pathogenesis of Parkinson's disease.
24392933 2014 c-Abl tyrosine kinase regulates cytokinesis of human airway smooth muscle cells.
24367707 2013 Abl family kinases regulate endothelial barrier function in vitro and in mice.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269846 2014 Single-cell analysis of K562 cells: an imatinib-resistant subpopulation is adherent and has upregulated expression of BCR-ABL mRNA and protein.
24262285 2014 Molecular analysis of the BCR-ABL1 kinase domain in chronic-phase chronic myelogenous leukemia treated with tyrosine kinase inhibitors in practice: study by the Nagasaki CML Study Group.
24223753 2013 MicroRNA-4723 inhibits prostate cancer growth through inactivation of the Abelson family of nonreceptor protein tyrosine kinases.
24190424 2014 Decreased c-Abl activity in PC-3 and LNCaP prostate cancer cells overexpressing the early growth response-1 protein.
24177958 2014 c-ABL tyrosine kinase modulates p53-dependent p21 induction and ensuing cell fate decision in response to DNA damage.
24112389 2013 Role of Abl in airway hyperresponsiveness and airway remodeling.
24041959 2013 Formation of long and winding nuclear F-actin bundles by nuclear c-Abl tyrosine kinase.
23980151 2013 Dissection of the BCR-ABL signaling network using highly specific monobody inhibitors to the SHP2 SH2 domains.
23974192 2013 Independent prognostic value of BCR-ABL1-like signature and IKZF1 deletion, but not high CRLF2 expression, in children with B-cell precursor ALL.
23959873 2013 Two-state dynamics of the SH3-SH2 tandem of Abl kinase and the allosteric role of the N-cap.
23934627 2014 Bcr-Abl activates AURKA and AURKB in chronic myeloid leukemia cells via AKT signaling.
23928308 2013 Intramolecular dynamics within the N-Cap-SH3-SH2 regulatory unit of the c-Abl tyrosine kinase reveal targeting to the cellular membrane.
23894305 2013 Low expression of miR-196b enhances the expression of BCR-ABL1 and HOXA9 oncogenes in chronic myeloid leukemogenesis.
23892407 2013 Doxorubicin induces atypical NF-?B activation through c-Abl kinase activity in breast cancer cells.
23872305 2014 NUP214-ABL1-mediated cell proliferation in T-cell acute lymphoblastic leukemia is dependent on the LCK kinase and various interacting proteins.
23842646 2013 Role of ABL family kinases in cancer: from leukaemia to solid tumours.
23840065 2013 Abl kinases are required for vascular function, Tie2 expression, and angiopoietin-1-mediated survival.
23831022 2013 Identification of the recognition sequence and target proteins for DJ-1 protease.
23799845 2013 BCR-ABL1 kinase domain mutations may persist at very low levels for many years and lead to subsequent TKI resistance.
23788109 2013 Additive antileukemia effects by GFI1B- and BCR-ABL-specific siRNA in advanced phase chronic myeloid leukemic cells.
23749639 2013 eIF4B phosphorylation by pim kinases plays a critical role in cellular transformation by Abl oncogenes.
23740246 2013 Role of the adapter protein Abi1 in actin-associated signaling and smooth muscle contraction.
23723070 2013 AMP-dependent kinase inhibits oxidative stress-induced caveolin-1 phosphorylation and endocytosis by suppressing the dissociation between c-Abl and Prdx1 proteins in endothelial cells.
23716543 2013 The BCR-ABLT315I mutation compromises survival in chronic phase chronic myelogenous leukemia patients resistant to tyrosine kinase inhibitors, in a matched pair analysis.
23691243 2013 WAVE2 regulates epithelial morphology and cadherin isoform switching through regulation of Twist and Abl.
23667855 2013 Two cases of myeloproliferative neoplasm with a concurrent JAK2 (V617F) mutation and BCR/ABL translocation without chronic myelogenous leukemia phenotype acquisition during hydroxyurea treatment.
23626584 2013 Structure and Function of Parkin, PINK1, and DJ-1, the Three Musketeers of Neuroprotection.
23575066 BCR-ABL1 in leukemia: disguise master outplays riding shotgun.
23513809 2012 [ABL fusion gene].
23458731 2012 STAT5 triggers BCR-ABL1 mutation by mediating ROS production in chronic myeloid leukaemia.
23448894 2013 New concepts for CML clonality.
23433665 2013 Frequency of ABL gene mutations in chronic myeloid leukemia patients resistant to imatinib and results of treatment switch to second-generation tyrosine kinase inhibitors.
23428668 2013 miR-29b suppresses CML cell proliferation and induces apoptosis via regulation of BCR/ABL1 protein.
23383002 2013 Mapping of p140Cap phosphorylation sites: the EPLYA and EGLYA motifs have a key role in tyrosine phosphorylation and Csk binding, and are substrates of the Abl kinase.
23325923 2013 c-Abl tyrosine kinase plays a critical role in ?2 integrin-dependent neutrophil migration by regulating Vav1 activity.
23319661 2013 Explaining why Gleevec is a specific and potent inhibitor of Abl kinase.
23318434 2013 Dual regulation of Myc by Abl.
23316053 2013 Structure and dynamic regulation of Abl kinases.
23303187 2013 Enhanced SH3/linker interaction overcomes Abl kinase activation by gatekeeper and myristic acid binding pocket mutations and increases sensitivity to small molecule inhibitors.
23289634 2013 BCR-ABL1 kinase domain mutation analysis in an Irish cohort of chronic myeloid leukemia patients.
23289360 2013 The BCR-ABL1 T315I mutation and additional genomic aberrations are dominant genetic lesions associated with disease progression in patients with chronic myelogenous leukemia resistant to tyrosine kinase inhibitor therapy.
23287430 2013 Decreased microRNA-30a levels are associated with enhanced ABL1 and BCR-ABL1 expression in chronic myeloid leukemia.
23277196 2013 Mechanisms of resistance to BCR-ABL and other kinase inhibitors.
23269583 2013 Analysis of the clinico-hematological relevance of the breakpoint location within M-BCR in chronic myeloid leukemia.
23223358 2013 BCR-ABL1 compound mutations in tyrosine kinase inhibitor-resistant CML: frequency and clonal relationships.
23207522 2013 Contributions of the RhoGEF activity of p210 BCR/ABL to disease progression.
23201011 2013 Dihydroartemisinin inhibits the Bcr/Abl oncogene at the mRNA level in chronic myeloid leukemia sensitive or resistant to imatinib.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23171811 2013 Variant of ETV6/ABL1 gene is associated with leukemia phenotype.
23146907 2013 Ableson kinases negatively regulate invadopodia function and invasion in head and neck squamous cell carcinoma by inhibiting an HB-EGF autocrine loop.
23130349 2012 Rare frameshift mutation Cys475Tyrfs(*)11 in the BCR/ABL kinase domain contributes to imatinib mesylate resistance in 2 Korean patients with chronic myelogenous leukemia.
23124138 2013 The tyrosine phosphatase TC48 interacts with and inactivates the oncogenic fusion protein BCR-Abl but not cellular Abl.
23117882 2013 ABL regulation by AXL promotes cisplatin resistance in esophageal cancer.
23087049 2013 Raf-1, actin dynamics, and abelson tyrosine kinase in human airway smooth muscle cells.
23065514 2013 The quantitative level of T315I mutated BCR-ABL predicts for major molecular response to second-line nilotinib or dasatinib treatment in patients with chronic myeloid leukemia.
23062378 2013 Emerging kinetics of BCR-ABL1 mutations and their effect on disease outcomes in chronic myeloid leukemia patients with imatinib failure.
23062104 2013 Concomitant detection of BCR-ABL translocation and JAK2 V617F mutation in five patients with myeloproliferative neoplasm at diagnosis.
23053188 2013 Impact of BCR-ABL mutations on response to dasatinib after imatinib failure in elderly patients with chronic-phase chronic myeloid leukemia.
23044928 2012 Three novel patient-derived BCR/ABL mutants show different sensitivity to second and third generation tyrosine kinase inhibitors.
23009571 2012 ABL kinase domain mutations in patients with chronic myeloid leukemia in Jordan.
23006999 2012 Tyrosine phosphorylation of a SNARE protein, syntaxin 17: implications for membrane trafficking in the early secretory pathway.
22988030 2012 Abelson tyrosine kinase controls phagosomal acidification required for killing of Mycobacterium tuberculosis in human macrophages.
22976291 2012 RIN1 orchestrates the activation of RAB5 GTPases and ABL tyrosine kinases to determine the fate of EGFR.
22957062 2012 Knocking down low molecular weight protein tyrosine phosphatase (LMW-PTP) reverts chemoresistance through inactivation of Src and Bcr-Abl proteins.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22879933 2012 c-Abl is an upstream regulator of acid sphingomyelinase in apoptosis induced by inhibition of integrins ?v?3 and ?v?5.
22870928 2013 Early detection and quantification of mutations in the tyrosine kinase domain of chimerical BCR-ABL1 gene combining high-resolution melting analysis and mutant-allele specific quantitative polymerase chain reaction.
22865780 2013 Enhanced expression of the PDGFR/Abl signaling pathway in aromatase inhibitor-resistant breast cancer.
22847163 2012 Concomitant BCR-ABL1 translocation and JAK2(V617F) mutation in three patients with myeloproliferative neoplasms.
22787435 2012 A requirement for SOCS-1 and SOCS-3 phosphorylation in Bcr-Abl-induced tumorigenesis.
22783572 2012 Comprehensive analysis of BCR/ABL variants in chronic myeloid leukemia patients using multiplex RT-PCR.
22782217 2013 TAT-CC fusion protein depresses the oncogenicity of BCR-ABL in vitro and in vivo through interrupting its oligomerization.
22733220 2012 The tyrosine kinase Abl is a component of macrophage podosomes and is required for podosome formation and function.
22693568 2012 Extensive gene-specific translational reprogramming in a model of B cell differentiation and Abl-dependent transformation.
22665066 2013 BCR-ABL regulates death receptor expression for TNF-related apoptosis-inducing ligand (TRAIL) in Philadelphia chromosome-positive leukemia.
22593461 2012 T315I mutation in Ph-positive acute lymphoblastic leukemia is associated with a highly aggressive disease phenotype: three case reports.
22591684 2012 Src, Akt, NF-?B, BCL-2 and c-IAP1 may be involved in an anti-apoptotic effect in patients with BCR-ABL positive and BCR-ABL negative acute lymphoblastic leukemia.
22590567 2012 Regulation of neuronal cell death by c-Abl-Hippo/MST2 signaling pathway.
22526369 2012 Comparative study of BCR-ABL1 quantification: Xpert assay, a feasible solution to standardization concerns.
22471662 2012 Therapeutic targeting of BCR-ABL: prognostic markers of response and resistance mechanism in chronic myeloid leukaemia.
22462553 2012 STI571 reduces TRAIL-induced apoptosis in colon cancer cells: c-Abl activation by the death receptor leads to stress kinase-dependent cell death.
22454521 2012 Caveolar domain organization and trafficking is regulated by Abl kinases and mDia1.
22447844 2012 Cyclin-dependent kinase 7/9 inhibitor SNS-032 abrogates FIP1-like-1 platelet-derived growth factor receptor ? and bcr-abl oncogene addiction in malignant hematologic cells.
22401567 2012 MutS homologue hMSH5: role in cisplatin-induced DNA damage response.
22380496 2012 The variant translocation of ABL1 gene t(2;9)(q21;q34) in a childhood T-cell acute lymphoblastic leukemia.
22378042 2012 c-Src and c-Abl kinases control hierarchic phosphorylation and function of the CagA effector protein in Western and East Asian Helicobacter pylori strains.
22334513 2012 Detection of early Abl kinase activation after ionizing radiation by using a peptide biosensor.
22327338 2012 c-ABL modulates MAP kinases activation downstream of VEGFR-2 signaling by direct phosphorylation of the adaptor proteins GRB2 and NCK1.
22327125 2012 Properties of bcr-abl-transformed mouse 12B1 cells secreting interleukin-2 and granulocyte-macrophage colony-stimulating factor: I. Derivation, genetic stability, oncogenicity and immunogenicity.
22314255 2012 BCR-ABL kinase domain mutations in tyrosine kinase inhibitors-naïve and -exposed Southeast Asian chronic myeloid leukemia patients.
22311485 2012 [Effect of dihydroartemisinin on the expression of BCR/ABL fusion gene in leukemia K562 cells].
22252550 2012 ABL1 regulates spindle orientation in adherent cells and mammalian skin.
22238610 2012 Interaction of proliferation cell nuclear antigen (PCNA) with c-Abl in cell proliferation and response to DNA damages in breast cancer.
22233112 2012 BCR-ABL activity measured by 50% inhibitory concentration for imatinib, p-CrkL/CrkL ratio or p-CrkL ratio in CD34+ cells of patients with chronic myeloid leukemia does not predict treatment response.
22231445 2012 STAP-2 interacts with and modulates BCR-ABL-mediated tumorigenesis.
22184410 2012 Chronic myeloid leukemia stem cells are not dependent on Bcr-Abl kinase activity for their survival.
22140458 2011 Fitness conferred by BCR-ABL kinase domain mutations determines the risk of pre-existing resistance in chronic myeloid leukemia.
22089930 2012 Enhanced ABL-inhibitor-induced MAPK-activation in T315I-BCR-ABL-expressing cells: a potential mechanism of altered leukemogenicity.
22054731 2011 BCR-ABL mutations in chronic myeloid leukemia.
22038725 2012 Characterization of ABL exon 7 deletion by molecular genetic and bioinformatic methods reveals no association with imatinib resistance in chronic myeloid leukemia.
22014333 2012 Abl-1-bridged tyrosine phosphorylation of VASP by Abelson kinase impairs association of VASP to focal adhesions and regulates leukaemic cell adhesion.
22001646 2011 Nuclear c-Abl-mediated tyrosine phosphorylation induces chromatin structural changes through histone modifications that include H4K16 hypoacetylation.
21998569 2011 Computational modeling of allosteric communication reveals organizing principles of mutation-induced signaling in ABL and EGFR kinases.
21961412 2011 [ABL domain kinase point mutations as a cause of resistance to therapy of patients with chronic myeloid leukemia with tyrosine kinase inhibitors. Single center experience].
21960589 2011 Developmental origins and impact of BCR-ABL1 fusion and IKZF1 deletions in monozygotic twins with Ph+ acute lymphoblastic leukemia.
21935931 2011 Bcr-Abl oncogene stimulates Jab1 expression via cooperative interaction of ?-catenin and STAT1 in chronic myeloid leukemia cells.
21903771 2011 BCR-ABL transcript dynamics support the hypothesis that leukemic stem cells are reduced during imatinib treatment.
21900237 2011 CDK1-mediated phosphorylation of Abi1 attenuates Bcr-Abl-induced F-actin assembly and tyrosine phosphorylation of WAVE complex during mitosis.
21892207 2012 c-Abl and Arg are activated in human primary melanomas, promote melanoma cell invasion via distinct pathways, and drive metastatic progression.
21888027 2011 Analysis of ABL kinase domain mutations conferring resistance to tyrosine kinase inhibitors in chronic myeloid leukemia cases from India.
21781306 2011 Tip60-mediated acetylation activates transcription independent apoptotic activity of Abl.
21764785 2011 In vivo imaging of Bcr-Abl overexpressing tumors with a radiolabeled imatinib analog as an imaging surrogate for imatinib.
21694468 2010 Plasma tyrosine kinase activity as a potential biomarker in BCR-ABL1-targeted therapy.
21693657 2011 Imatinib sensitivity in BCR-ABL1-positive chronic myeloid leukemia cells is regulated by the remaining normal ABL1 allele.
21674858 Frequency of BCR-ABL fusion transcripts in Serbian patients with chronic myeloid leukemia.
21641753 2011 Purification of TAT-CC-HA protein under native condition, and its transduction analysis and biological effects on BCR-ABL positive cells.
21591355 2010 [Implementation of direct sequencing as a method of ABL gene mutations analysis in patients with chronic myeloid leukemia treated with tyrosine kinase inhibitor].
21527514 2011 p90RSK2 is essential for FLT3-ITD- but dispensable for BCR-ABL-induced myeloid leukemia.
21504383 2011 Does pretreatment fluorescence in situ hybridization for BCR-ABL predict imatinib-associated hematologic toxicity in chronic myeloid leukemia?
21480391 2011 Overcoming resistance to fulvestrant (ICI182,780) by downregulating the c-ABL proto-oncogene in breast cancer.
21461967 2012 Molecular cytogenetic study of derivative chromosome 9 deletion in chronic myeloid leukemia patients.
21455220 2011 Abl interconnects oncogenic Met and p53 core pathways in cancer cells.
21454413 2011 Epigenetic silencing of microRNA-203 dysregulates ABL1 expression and drives Helicobacter-associated gastric lymphomagenesis.
21435002 2011 ABL1 fusion genes in hematological malignancies: a review.
21388681 2011 The t(1;9)(p34;q34) fusing ABL1 with SFPQ, a pre-mRNA processing gene, is recurrent in acute lymphoblastic leukemias.
21368377 2011 Neuronal c-Abl overexpression leads to neuronal loss and neuroinflammation in the mouse forebrain.
21321929 2011 The c-Abl tyrosine kinase controls protein kinase C?-induced Fli-1 phosphorylation in human dermal fibroblasts.
21320496 2011 Identification and functional analysis of a new phosphorylation site (Y398) in the SH3 domain of Abi-1.
21269460 2011 Initial characterization of the human central proteome.
21266020 2011 Three novel alternative splicing mutations in BCR-ABL1 detected in CML patients with resistance to kinase inhibitors.
21239056 2011 BCR-ABL1 mutations in patients with imatinib-resistant Philadelphia chromosome-positive leukemia by use of the PCR-Invader assay.
21221851 2012 BCR-ABL isoforms associated with intrinsic or acquired resistance to imatinib: more heterogeneous than just ABL kinase domain point mutations?
21220745 2011 c-Abl regulates Mcl-1 gene expression in chronic lymphocytic leukemia cells.
21203397 2010 Bcr/Abl interferes with the Fanconi anemia/BRCA pathway: implications in the chromosomal instability of chronic myeloid leukemia cells.
21183952 2011 Janus kinase 2 regulates Bcr-Abl signaling in chronic myeloid leukemia.
21156844 2011 Results of allogeneic hematopoietic stem cell transplantation for chronic myelogenous leukemia patients who failed tyrosine kinase inhibitors after developing BCR-ABL1 kinase domain mutations.
21129254 2010 [Effect of gemcitabine on granulocyte colony-stimulating factor receptor and bcr/abl mRNA in patients with chronic myeloid leukemia].
21072043 2011 Inhibition of Grb2 expression demonstrates an important role in BCR-ABL-mediated MAPK activation and transformation of primary human hematopoietic cells.
21071472 2011 FTY720-induced human pulmonary endothelial barrier enhancement is mediated by c-Abl.
21045136 2010 Exon 7 deletion in the bcr-abl gene is frequent in chronic myeloid leukemia patients and is not correlated with resistance against imatinib.
20974687 2011 BCR-ABL stimulates mutagenic homologous DNA double-strand break repair via the DNA-end-processing factor CtIP.
20937825 2010 Abl kinases are required for invadopodia formation and chemokine-induced invasion.
20863169 2011 BCR-ABL1 transcript levels increase in peripheral blood but not in granulocytes after physical exercise in patients with chronic myeloid leukemia.
20861316 2010 Abl tyrosine kinase phosphorylates nonmuscle Myosin light chain kinase to regulate endothelial barrier function.
20841568 2010 ABL tyrosine kinases: evolution of function, regulation, and specificity.
20823226 2010 Phosphorylation by the c-Abl protein tyrosine kinase inhibits parkin's ubiquitination and protective function.
20724541 2010 BMI1 collaborates with BCR-ABL in leukemic transformation of human CD34+ cells.
20717963 2011 Bcr-Abl-induced tyrosine phosphorylation of Emi1 to stabilize Skp2 protein via inhibition of ubiquitination in chronic myeloid leukemia cells.
20697894 2011 Characteristics of BCR-ABL kinase domain point mutations in Chinese imatinib-resistant chronic myeloid leukemia patients.
20697350 2010 The proximal signaling network of the BCR-ABL1 oncogene shows a modular organization.
20633771 2010 A unique BCR-ABL1 transcript with the insertion of intronic sequence from BCR and ABL1 genes in a patient with Philadelphia-positive chronic myeloid leukemia: a case study.
20629032 2010 The tyrosine kinase c-Abl promotes proliferation and is expressed in atypical teratoid and malignant rhabdoid tumors.
20598684 2010 Abi1/Hssh3bp1 pY213 links Abl kinase signaling to p85 regulatory subunit of PI-3 kinase in regulation of macropinocytosis in LNCaP cells.
20595523 2010 Uncommon BCR-ABL kinase domain mutations in kinase inhibitor-resistant chronic myelogenous leukemia and Ph+ acute lymphoblastic leukemia show high rates of regression, suggesting weak selective effects.
20585028 2010 c-Abl mediates high NaCl-induced phosphorylation and activation of the transcription factor TonEBP/OREBP.
20581864 2010 F-actin-binding domain of c-Abl regulates localized phosphorylation of C3G: role of C3G in c-Abl-mediated cell death.
20563669 2010 The c-Abl tyrosine kinase stabilizes Pitx1 in the apoptotic response to DNA damage.
20512393 2011 Rapid and sensitive allele-specific (AS)-RT-PCR assay for detection of T315I mutation in chronic myeloid leukemia patients treated with tyrosine-kinase inhibitors.
20482842 2010 Pristimerin induces apoptosis in imatinib-resistant chronic myelogenous leukemia cells harboring T315I mutation by blocking NF-kappaB signaling and depleting Bcr-Abl.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452982 2010 Expression of a Src family kinase in chronic myelogenous leukemia cells induces resistance to imatinib in a kinase-dependent manner.
20425353 2007 Genomic instability: The cause and effect of BCR/ABL tyrosine kinase.
20417104 2010 c-Abl, Lamellipodin, and Ena/VASP proteins cooperate in dorsal ruffling of fibroblasts and axonal morphogenesis.
20367437 2010 Mutations in ABL kinase domain are associated with inferior progression-free survival.
20357770 2010 A potent and highly specific FN3 monobody inhibitor of the Abl SH2 domain.
20234815 2010 Enhanced resistance to tamoxifen by the c-ABL proto-oncogene in breast cancer.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20152788 2010 Inhibitors of the Abl kinase directed at either the ATP- or myristate-binding site.
20124512 2010 c-Abl mediates endothelial apoptosis induced by inhibition of integrins alphavbeta3 and alphavbeta5 and by disruption of actin.
20082857 2010 ABL1 gene deletion without BCR/ABL1 rearrangement in a young adolescent with precursor B-cell acute lymphoblastic leukemia: clinical study and literature review.
20079431 2010 The Bcr-Abl kinase regulates the actin cytoskeleton via a GADS/Slp-76/Nck1 adaptor protein pathway.
20073070 2010 ABL1 rearrangements in T-cell acute lymphoblastic leukemia.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20038234 2010 Kinase domain mutations of BCR-ABL identified at diagnosis before imatinib-based therapy are associated with progression in patients with high Sokal risk chronic phase chronic myeloid leukemia.
20010464 2009 Frequency of BCR-ABL gene mutations in Polish patients with chronic myeloid leukemia treated with imatinib: a final report of the MAPTEST study.
20007699 2010 BCR-ABL gene expression is required for its mutations in a novel KCL-22 cell culture model for acquired resistance of chronic myelogenous leukemia.
19968720 2010 Peripheral blood vs. bone marrow for molecular monitoring of BCR-ABL1 levels in chronic myelogenous leukemia, a retrospective analysis in allogeneic bone marrow recipients.
19954044 2009 [The role of BCR/ABL isoforms in the presentations and outcome of Philadelphia-positive acute lymphoblastic leukemia in adult patients].
19931180 2010 Description of a new BCR-ABL point mutation in a CML patient with evolution to lymphoid blast crisis.
19914245 2010 c-Abl tyrosine kinase interacts with MAVS and regulates innate immune response.
19906645 2010 Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
19897486 2010 Claudin-1 acts through c-Abl-protein kinase Cdelta (PKCdelta) signaling and has a causal role in the acquisition of invasive capacity in human liver cells.
19891780 2009 Cbl-associated protein is tyrosine phosphorylated by c-Abl and c-Src kinases.
19876398 2009 Reciprocal t(9;22) ABL/BCR fusion proteins: leukemogenic potential and effects on B cell commitment.
19833721 2009 Dynamin 2 and c-Abl are novel regulators of hyperoxia-mediated NADPH oxidase activation and reactive oxygen species production in caveolin-enriched microdomains of the endothelium.
19829692 2009 IL-3 and oncogenic Abl regulate the myeloblast transcriptome by altering mRNA stability.
19789182 2009 Tyrosine phosphorylation of nuclear-membrane protein emerin by Src, Abl and other kinases.
19768693 2010 Dynamic change of T315I BCR-ABL kinase domain mutation in Korean chronic myeloid leukaemia patients during treatment with Abl tyrosine kinase inhibitors.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19724931 2009 DNA vaccination against bcr-abl-positive cells in mice.
19700222 2011 c-Abl tyrosine kinase modulates tau pathology and Cdk5 phosphorylation in AD transgenic mice.
19697154 2010 BCR/ABL downregulates DNA-PK(CS)-dependent and upregulates backup non-homologous end joining in leukemic cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19679652 2009 N-myristoylated c-Abl tyrosine kinase localizes to the endoplasmic reticulum upon binding to an allosteric inhibitor.
19660459 2009 Tyrosine kinase inhibition: Ligand binding and conformational change in c-Kit and c-Abl.
19658100 2009 Phosphorylation of the SSBP2 and ABL proteins by the ZNF198-FGFR1 fusion kinase seen in atypical myeloproliferative disorders as revealed by phosphopeptide-specific MS.
19657362 2009 BCR/ABL kinase interacts with and phosphorylates the RAD51 paralog, RAD51B.
19652056 2009 Impact of baseline BCR-ABL mutations on response to nilotinib in patients with chronic myeloid leukemia in chronic phase.
19643477 2010 mTOR inhibitor RAD001 (Everolimus) enhances the effects of imatinib in chronic myeloid leukemia by raising the nuclear expression of c-ABL protein.
19625707 2009 Determining the rise in BCR-ABL RNA that optimally predicts a kinase domain mutation in patients with chronic myeloid leukemia on imatinib.
19608682 2009 An accurate and rapid flow cytometric diagnosis of BCR-ABL positive acute lymphoblastic leukemia.
19571320 2009 BCR-ABL promotes the frequency of mutagenic single-strand annealing DNA repair.
19557636 2009 New mutations detected by denaturing high performance liquid chromatography during screening of exon 6 bcr-abl mutations in patients with chronic myeloid leukemia treated with tyrosine kinase inhibitors.
19542604 2009 The microtubule-associated protein tau is also phosphorylated on tyrosine.
19470755 2009 Cdo binds Abl to promote p38alpha/beta mitogen-activated protein kinase activity and myogenic differentiation.
19442657 2009 Evidence for a direct involvement of hMSH5 in promoting ionizing radiation induced apoptosis.
19427856 2009 Detection of c-Abl kinase-promoted phosphorylation of Rad51 by specific antibodies reveals that Y54 phosphorylation is dependent on that of Y315.
19423701 2009 Phosphorylation of RACK1 on tyrosine 52 by c-Abl is required for insulin-like growth factor I-mediated regulation of focal adhesion kinase.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19383348 2008 The chemokine interleukin-8 and the surface activation protein CD69 are markers for Bcr-Abl activity in chronic myeloid leukemia.
19381274 2009 Unc119 protects from Shigella infection by inhibiting the Abl family kinases.
19369965 2009 The gatekeeper mutation T315I confers resistance against small molecules by increasing or restoring the ABL-kinase activity accompanied by aberrant transphosphorylation of endogenous BCR, even in loss-of-function mutants of BCR/ABL.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19363261 2009 Altered subcellular distribution of c-Abl in Alzheimer's disease.
19357699 2009 BCR-ABL promotes neutrophil differentiation in the chronic phase of chronic myeloid leukemia by downregulating c-Jun expression.
19332026 2009 BimL upregulation induced by BCR cross-linking in BL41 Burkitt's lymphoma results from a splicing mechanism of the BimEL mRNA.
19295548 2009 Bcr-Abl-mediated redox regulation of the PI3K/AKT pathway.
19290927 2009 Abl tyrosine kinases in T-cell signaling.
19285032 2009 c-ABL tyrosine kinase stabilizes RAD51 chromatin association.
19275932 2009 Reciprocal regulation of Abl and receptor tyrosine kinases.
19261608 2009 Depletion of Pleckstrin homology domain leucine-rich repeat protein phosphatases 1 and 2 by Bcr-Abl promotes chronic myelogenous leukemia cell proliferation through continuous phosphorylation of Akt isoforms.
19260121 2009 Complexity of BCR-ABL kinase domain mutations during the course of therapy with tyrosine kinase inhibitors in chronic myeloid leukemia.
19234221 2009 c-Abl kinase is required for beta 2 integrin-mediated neutrophil adhesion.
19203793 2009 Simultaneous occurrence of variant Philadelphia translocations and ABL mutations in two patients with chronic myeloid leukemia.
19180499 2009 Molecular framework for response to imatinib mesylate in systemic sclerosis.
19156526 2009 Proliferating cell nuclear antigen destabilizes c-Abl tyrosine kinase and regulates cell apoptosis in response to DNA damage.
19135771 2009 Expression of P190 and P210 BCR/ABL1 in normal human CD34(+) cells induces similar gene expression profiles and results in a STAT5-dependent expansion of the erythroid lineage.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19108887 2009 Increasing the BCR-ABL expression levels and/or the occurrence of ABL point mutations does not always predict resistance to Imatinib Mesylate in BCR-ABL positive acute lymphoblastic leukemia.
19075013 2009 c-Abl phosphorylates Hdmx and regulates its interaction with p53.
19061839 2008 Transient potent BCR-ABL inhibition is sufficient to commit chronic myeloid leukemia cells irreversibly to apoptosis.
19052872 2009 Involvement of c-Abl, p53 and the MAP kinase JNK in the cell death program initiated in A2E-laden ARPE-19 cells by exposure to blue light.
19048492 2008 Analysis and comparison of clinicohematological parameters and molecular and cytogenetic response of two Bcr/Abl fusion transcripts.
19020542 2009 BCR/ABL induces chromosomal instability after genotoxic stress and alters the cell death threshold.
19016792 2009 H. pylori selectively blocks EGFR endocytosis via the non-receptor kinase c-Abl and CagA.
19001122 2008 Induction of cell retraction by the combined actions of Abl-CrkII and Rho-ROCK1 signaling.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18945674 2008 Abl kinases regulate autophagy by promoting the trafficking and function of lysosomal components.
18936177 2009 Abelson tyrosine kinase facilitates Salmonella enterica serovar Typhimurium entry into epithelial cells.
18827185 2009 Molecular biology of bcr-abl1-positive chronic myeloid leukemia.
18809728 2008 The WAVE2 complex regulates T cell receptor signaling to integrins via Abl- and CrkL-C3G-mediated activation of Rap1.
18794796 2008 An inhibitor-resistant mutant of Hck protects CML cells against the antiproliferative and apoptotic effects of the broad-spectrum Src family kinase inhibitor A-419259.
18784740 2008 Intrinsic differences between the catalytic properties of the oncogenic NUP214-ABL1 and BCR-ABL1 fusion protein kinases.
18775435 2008 Tyrosine phosphorylation in the SH3 domain disrupts negative regulatory interactions within the c-Abl kinase core.
18775312 2008 Structural coupling of SH2-kinase domains links Fes and Abl substrate recognition and kinase activation.
18771174 2008 [The involvement of c-Abl and D40 (AF15q14/CASC5) proteins in the regulation of cell proliferation and cancer].
18765637 2008 Tyrosine phosphorylation of the nuclear receptor coactivator AIB1/SRC-3 is enhanced by Abl kinase and is required for its activity in cancer cells.
18704194 2008 Ablation of PI3K blocks BCR-ABL leukemogenesis in mice, and a dual PI3K/mTOR inhibitor prevents expansion of human BCR-ABL+ leukemia cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18687796 2008 ABL kinase domain pseudoexon insertion is not uncommon in BCR-ABL transcripts.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18619508 2008 L-selectin ligation-induced CSF-1 gene transcription is regulated by AP-1 in a c-Abl kinase-dependent manner.
18614052 2008 Kinase activation and transformation by NUP214-ABL1 is dependent on the context of the nuclear pore.
18603549 2008 ABL single nucleotide polymorphisms may masquerade as BCR-ABL mutations associated with resistance to tyrosine kinase inhibitors in patients with chronic myeloid leukemia.
18546844 2008 [PI3K-AKT network roles in infectious diseases].
18538733 2008 Genetic and epigenetic silencing of microRNA-203 enhances ABL1 and BCR-ABL1 oncogene expression.
18490454 2008 Cooperative roles of c-Abl and Cdk5 in regulation of p53 in response to oxidative stress.
18480061 2008 Role of c-Abl kinase in DNA mismatch repair-dependent G2 cell cycle checkpoint arrest responses.
18480060 2008 DNA mismatch repair-dependent activation of c-Abl/p73alpha/GADD45alpha-mediated apoptosis.
18427551 2008 Inhibition of Abl tyrosine kinase enhances nerve growth factor-mediated signaling in Bcr-Abl transformed cells via the alteration of signaling complex and the receptor turnover.
18413724 2008 BCR/ABL inhibits mismatch repair to protect from apoptosis and induce point mutations.
18406870 2008 Mechanisms of genesis of variant translocation in chronic myeloid leukemia are not correlated with ABL1 or BCR deletion status or response to imatinib therapy.
18401414 2008 Sphingosine kinase-1 is a downstream regulator of imatinib-induced apoptosis in chronic myeloid leukemia cells.
18391983 2008 Activated c-Abl tyrosine kinase in malignant solid tumors.
18369471 2008 RNA interference screen identifies Abl kinase and PDGFR signaling in Chlamydia trachomatis entry.
18362889 2008 Pharmacological inhibition of c-Abl compromises genetic stability and DNA repair in Bcr-Abl-negative cells.
18339898 2008 BCR-ABL1 alters SDF-1alpha-mediated adhesive responses through the beta2 integrin LFA-1 in leukemia cells.
18328268 2008 Allosteric inhibition of the nonMyristoylated c-Abl tyrosine kinase by phosphopeptides derived from Abi1/Hssh3bp1.
18305550 2008 Sequencing of subcloned PCR products facilitates earlier detection of BCR-ABL1(T315I) and other mutants compared to direct sequencing of the ABL1 kinase domain.
18305217 2008 The c-Abl tyrosine kinase regulates actin remodeling at the immune synapse.
18287094 2008 Suppression of interferon (IFN)-inducible genes and IFN-mediated functional responses in BCR-ABL-expressing cells.
18280240 2008 Yap1 phosphorylation by c-Abl is a critical step in selective activation of proapoptotic genes in response to DNA damage.
18262060 2008 A masked BCR/ABL rearrangement in a case of chronic myeloid leukemia with translocation t(3;9)(p14;q34).
18182299 2008 Emerging roles of Abl family tyrosine kinases in microbial pathogenesis.
18180382 2008 BCR-ABL1 mediates up-regulation of Fyn in chronic myelogenous leukemia.
18161990 2008 Phosphorylation of c-Abl by protein kinase Pak2 regulates differential binding of ABI2 and CRK.
18095154 2008 Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers.
18089786 2007 MUC1 oncoprotein regulates Bcr-Abl stability and pathogenesis in chronic myelogenous leukemia cells.
18082628 2008 Expression of BCR-ABL1 oncogene relative to ABL1 gene changes overtime in chronic myeloid leukemia.
18059481 2008 Subcellular distribution of p210(BCR-ABL) in CML cell lines and primary CD34+ CML cells.
18036399 2007 Confirmation of a novel recurrent association: BCR-ABL t(9;22) and t(19;21).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17972958 2008 Chronic myeloproliferative diseases with concurrent BCR-ABL junction and JAK2V617F mutation.
17956664 2007 [Expression of beta-Catenin Gene in CML and its relationship with bcr/abl].
17943163 2008 MT1-MMP as a downstream target of BCR-ABL/ABL interactor 1 signaling: polarized distribution and involvement in BCR-ABL-stimulated leukemic cell migration.
17928051 2008 A multiplex PCR for improved detection of typical and atypical BCR-ABL fusion transcripts.
17925491 2008 Identification of novel posttranscriptional targets of the BCR/ABL oncoprotein by ribonomics: requirement of E2F3 for BCR/ABL leukemogenesis.
17893873 2008 c-Abl activates p38 MAPK independently of its tyrosine kinase activity: Implications in cisplatin-based therapy.
17889935 2008 Sequential mutations causing resistance to both Imatinib Mesylate and Dasatinib in a chronic myeloid leukaemia patient progressing to lymphoid blast crisis.
17888034 2007 Fibroblast growth factor receptor 1 oncogene partner as a novel prognostic biomarker and therapeutic target for lung cancer.
17804707 2007 Crystal structure of the T315I Abl mutant in complex with the aurora kinases inhibitor PHA-739358.
17768119 2007 Clinical outcome of 27 imatinib mesylate-resistant chronic myelogenous leukemia patients harboring a T315I BCR-ABL mutation.
17764157 2007 Proapoptotic function of the nuclear Crk II adaptor protein.
17762503 2007 Frequency of BCR-ABL fusion oncogene in Pakistani childhood acute lymphoid leukemia (ALL) patients reflects ethnic differences in molecular genetics of ALL.
17761812 2007 Cytokine-dependent imatinib resistance in mouse BCR-ABL+, Arf-null lymphoblastic leukemia.
17710227 2007 Sequential ABL kinase inhibitor therapy selects for compound drug-resistant BCR-ABL mutations with altered oncogenic potency.
17695727 2007 Regulation for nuclear targeting of the Abl tyrosine kinase in response to DNA damage.
17638918 2007 BCR-tyrosine 177 plays an essential role in Ras and Akt activation and in human hematopoietic progenitor transformation in chronic myelogenous leukemia.
17626041 2007 Cockayne syndrome protein B interacts with and is phosphorylated by c-Abl tyrosine kinase.
17623672 2007 c-Abl-mediated phosphorylation of WAVE3 is required for lamellipodia formation and cell migration.
17620332 2007 Role of c-Abl in directing metabolic versus mitogenic effects in insulin receptor signaling.
17604596 2007 Docosahexaenoic acid enhances the toxic effect of imatinib on Bcr-Abl expressing HL-60 cells.
17599053 2007 Sphingosine kinase-1 mediates BCR/ABL-induced upregulation of Mcl-1 in chronic myeloid leukemia cells.
17597804 2007 Expression of the p210BCR-ABL oncoprotein drives centrosomal hypertrophy and clonal evolution in human U937 cells.
17587335 2007 Anaplasma phagocytophilum AnkA secreted by type IV secretion system is tyrosine phosphorylated by Abl-1 to facilitate infection.
17579186 2007 The immunogenicity of Bcr-Abl expressing dendritic cells is dependent on the Bcr-Abl kinase activity and dominated by Bcr-Abl regulated antigens.
17570524 2008 A recurrent splicing variant without c-ABL Exon 7 in Imatinib-resistant patients.
17541395 2007 A new partner gene fused to ABL1 in a t(1;9)(q24;q34)-associated B-cell acute lymphoblastic leukemia.
17525531 2007 Differential repression of c-myc and cdc2 gene expression by ERF and PE-1/METS.
17486070 2007 Oncogenic activation of c-Abl in non-small cell lung cancer cells lacking FUS1 expression: inhibition of c-Abl by the tumor suppressor gene product Fus1.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17470736 2007 Instability of BCR-ABL gene in primary and cultured chronic myeloid leukemia stem cells.
17470729 2007 Chronic myelogenous leukemia progenitors display a genetically unstable personality.
17452790 2007 Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.
17374743 2007 Ubp43 regulates BCR-ABL leukemogenesis via the type 1 interferon receptor signaling.
17366548 2007 A fifteen-year cytogenetic remission following interferon treatment in a patient with an indolent ETV6-ABL positive myeloproliferative syndrome.
17349636 2007 Upregulation of the TGFbeta signalling pathway by Bcr-Abl: implications for haemopoietic cell growth and chronic myeloid leukaemia.
17347407 2007 Role of BCR/ABL gene-expression levels in determining the phenotype and imatinib sensitivity of transformed human hematopoietic cells.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17339230 2007 c-Abl tyrosine kinase activates p21 transcription via interaction with p53.
17318191 2007 Bcr-Abl stabilizes beta-catenin in chronic myeloid leukemia through its tyrosine phosphorylation.
17306540 2007 A critical role for cortactin phosphorylation by Abl-family kinases in PDGF-induced dorsal-wave formation.
17303698 2007 Identification of BCR-ABL point mutations conferring resistance to the Abl kinase inhibitor AMN107 (nilotinib) by a random mutagenesis study.
17268511 2007 A novel BCR-ABL fusion transcript (e18a2) in a child with chronic myeloid leukemia.
17252009 2007 Mutations of the BCR-ABL-kinase domain occur in a minority of patients with stable complete cytogenetic response to imatinib.
17237826 2007 c-Cbl-facilitated cytoskeletal effects in v-Abl-transformed fibroblasts are regulated by membrane association of c-Cbl.
17196995 2007 aCGH local copy number aberrations associated with overall copy number genomic instability in colorectal cancer: coordinate involvement of the regions including BCR and ABL.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17164530 2007 Structural biology contributions to the discovery of drugs to treat chronic myelogenous leukaemia.
17160020 2007 Phosphorylation of Helicobacter pylori CagA by c-Abl leads to cell motility.
17129785 2006 Force sensing by mechanical extension of the Src family kinase substrate p130Cas.
17126298 2007 Tyrosine 311 is phosphorylated by c-Abl and promotes the apoptotic effect of PKCdelta in glioma cells.
17112510 2007 Consequences of Shb and c-Abl interactions for cell death in response to various stress stimuli.
17101133 2006 NESH (Abi-3) is present in the Abi/WAVE complex but does not promote c-Abl-mediated phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16998483 2006 Requirement for CD44 in homing and engraftment of BCR-ABL-expressing leukemic stem cells.
16966279 2006 Distinct biological impact of dephosphorylation vs. downregulation of p210Bcr-Abl: implications for imatinib mesylate response and resistance.
16943190 2006 Abl tyrosine kinase regulates endocytosis of the epidermal growth factor receptor.
16912036 2006 Src family kinases phosphorylate the Bcr-Abl SH3-SH2 region and modulate Bcr-Abl transforming activity.
16899465 2006 c-Abl interacts with the WAVE2 signaling complex to induce membrane ruffling and cell spreading.
16888623 2006 MUC1 oncoprotein blocks nuclear targeting of c-Abl in the apoptotic response to DNA damage.
16867995 2006 Transforming growth factor beta activation of c-Abl is independent of receptor internalization and regulated by phosphatidylinositol 3-kinase and PAK2 in mesenchymal cultures.
16831423 2006 Abl kinase interacts with and phosphorylates vinexin.
16678104 2006 Interaction between c-Abl and Arg tyrosine kinases and proteasome subunit PSMA7 regulates proteasome degradation.
16648821 2006 c-Abl acetylation by histone acetyltransferases regulates its nuclear-cytoplasmic localization.
16640460 2006 A Src-like inactive conformation in the abl tyrosine kinase domain.
16636310 2006 Nuclear accumulations of p53 and Mdm2 are accompanied by reductions in c-Abl and p300 in zinc-depleted human hepatoblastoma cells.
16630659 2006 HOXA9 gene expression in the chronic myeloid leukemia progression.
16543148 2006 Organization of the SH3-SH2 unit in active and inactive forms of the c-Abl tyrosine kinase.
16448696 2006 Assessment of bone marrow mesenchymal stem cell biological characteristics and support hemotopoiesis function in patients with chronic myeloid leukemia.
16443220 2006 Characterization of p87C3G, a novel, truncated C3G isoform that is overexpressed in chronic myeloid leukemia and interacts with Bcr-Abl.
16424036 2006 Structure of the kinase domain of an imatinib-resistant Abl mutant in complex with the Aurora kinase inhibitor VX-680.
16410245 2006 Activation of Bak and Bax through c-abl-protein kinase Cdelta-p38 MAPK signaling in response to ionizing radiation in human non-small cell lung cancer cells.
16397227 2006 Physical and functional interaction between hMSH5 and c-Abl.
16386788 2006 The incidence of T-cell receptor gene rearrangements in childhood B-lineage acute lymphoblastic leukemia is related to immunophenotype and fusion oncogene expression.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16205638 2006 BCR-ABL1 induces aberrant splicing of IKAROS and lineage infidelity in pre-B lymphoblastic leukemia cells.
16199863 2005 Abl kinases regulate actin comet tail elongation via an N-WASP-dependent pathway.
16158059 2005 Transactivation of Abl by the Crk II adapter protein requires a PNAY sequence in the Crk C-terminal SH3 domain.
16151465 2005 A single nucleotide polymorphism in the coding region of ABL and its effects on sensitivity to imatinib.
16091742 2005 c-Abl regulates early growth response protein (EGR1) in response to oxidative stress.
16014719 2005 Tyrosine 394 is phosphorylated in Alzheimer's paired helical filament tau and in fetal tau with c-Abl as the candidate tyrosine kinase.
15961388 2005 Identification of TopBP1 as a c-Abl-interacting protein and a repressor for c-Abl expression.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15886098 2005 RIN1 is an ABL tyrosine kinase activator and a regulator of epithelial-cell adhesion and migration.
15857938 2005 Bcr-Abl regulates osteopontin transcription via Ras, PI-3K, aPKC, Raf-1, and MEK.
15735728 2005 Chronic myeloid leukaemia: an investigation into the role of Bcr-Abl-induced abnormalities in glucose transport regulation.
15723338 2005 Interpretation of submicroscopic deletions of the BCR or ABL gene should not depend on extra signal-FISH: problems in interpretation of submicroscopic deletion of the BCR or ABL gene with extra signal-FISH.
15716990 2005 Derivative chromosome 9 deletions are a significant feature of childhood Philadelphia chromosome positive acute lymphoblastic leukaemia.
15696159 2005 JNK phosphorylation of 14-3-3 proteins regulates nuclear targeting of c-Abl in the apoptotic response to DNA damage.
15686624 2005 Role of c-Abl in the DNA damage stress response.
15661746 2005 Insights into selective activation of p53 DNA binding by c-Abl.
15657136 2005 Abelson-interactor-1 promotes WAVE2 membrane translocation and Abelson-mediated tyrosine phosphorylation required for WAVE2 activation.
15657060 2005 c-Abl tyrosine kinase regulates caspase-9 autocleavage in the apoptotic response to DNA damage.
15626746 2005 Identification of mcl-1 as a BCR/ABL-dependent target in chronic myeloid leukemia (CML): evidence for cooperative antileukemic effects of imatinib and mcl-1 antisense oligonucleotides.
15608616 2005 Abl-kinase-sensitive levels of ERK5 and its intrinsic basal activity contribute to leukaemia cell survival.
15591787 Abi enhances Abl-mediated CDC2 phosphorylation and inactivation.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15583852 2004 Abl: the prototype of oncogenic fusion proteins.
15556646 2004 Catalytic domains of tyrosine kinases determine the phosphorylation sites within c-Cbl.
15542838 2004 Bcr-Abl-mediated protection from apoptosis downstream of mitochondrial cytochrome c release.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15481444 2004 Fluorescent in situ hybridization analysis of Philadelphia chromosome-negative chronic myeloid leukemia with the bcr/abl fusion gene.
15448168 2004 Phosphorylation of DNA topoisomerase I by the c-Abl tyrosine kinase confers camptothecin sensitivity.
15361874 2004 Fusion of NUP214 to ABL1 on amplified episomes in T-cell acute lymphoblastic leukemia.
15302586 2004 The c-Fes tyrosine kinase cooperates with the breakpoint cluster region protein (Bcr) to induce neurite extension in a Rac- and Cdc42-dependent manner.
15175272 2004 The intranuclear localization and function of YT521-B is regulated by tyrosine phosphorylation.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15143187 2004 Autophosphorylation of JAK2 on tyrosines 221 and 570 regulates its activity.
15031292 2004 The c-Abl tyrosine kinase phosphorylates the Fe65 adaptor protein to stimulate Fe65/amyloid precursor protein nuclear signaling.
14993251 2004 The BCR-ABL1 kinase bypasses selection for the expression of a pre-B cell receptor in pre-B acute lymphoblastic leukemia cells.
14966468 2004 Detection of bcr-abl gene expression at a low level in blood cells of some patients with essential thrombocythemia.
14745431 2004 High incidence of BCR-ABL kinase domain mutations and absence of mutations of the PDGFR and KIT activation loops in CML patients with secondary resistance to imatinib.
14708008 2004 Regulation of the c-Abl and Bcr-Abl tyrosine kinases.
14679214 2004 A novel proteomic screen for peptide-protein interactions.
14670960 2004 Bcr-Abl regulates protein kinase Ciota (PKCiota) transcription via an Elk1 site in the PKCiota promoter.
14657955 2004 TaqMan RT-PCR assay coupled with capillary electrophoresis for quantification and identification of bcr-abl transcript type.
14581377 2003 Induction of apoptosis by apicidin, a histone deacetylase inhibitor, via the activation of mitochondria-dependent caspase cascades in human Bcr-Abl-positive leukemia cells.
14534537 2003 Leukemia-associated translocation products able to activate RAS modify PML and render cells sensitive to arsenic-induced apoptosis.
14527680 2003 How often does the myristoylated N-terminal latch of c-Abl come off?
12952226 2003 Deletion of the 5'ABL region in Philadelphia chromosome positive chronic myeloid leukemia: frequency, origin and prognosis.
12950161 2003 Catalase is regulated by ubiquitination and proteosomal degradation. Role of the c-Abl and Arg tyrosine kinases.
12944467 2003 Werner syndrome protein phosphorylation by abl tyrosine kinase regulates its activity and distribution.
12928501 2003 Modulation of DNA damage-induced apoptosis by cell adhesion is independently mediated by p53 and c-Abl.
12921956 2003 ABL-kinase domain point mutation as a cause of imatinib (STI571) resistance in CML patient who progress to myeloid blast crisis.
12893824 2003 Glutathione peroxidase 1 is regulated by the c-Abl and Arg tyrosine kinases.
12890867 2003 Expression of BCR/ABL and BCL-2 in myeloid progenitors leads to myeloid leukemias.
12824179 2003 c-Abl tyrosine kinase selectively regulates p73 nuclear matrix association.
12810679 2003 c-Abl stabilizes p73 by a phosphorylation-augmented interaction.
12781448 2003 Amplification of the BCR/ABL fusion gene clustered on a masked Philadelphia chromosome in a patient with myeloblastic crisis of chronic myelocytic leukemia.
12777400 2003 Catalase activity is regulated by c-Abl and Arg in the oxidative stress response.
12777393 2003 Dok-R binds c-Abl and regulates Abl kinase activity and mediates cytoskeletal reorganization.
12775773 2003 Regulation of F-actin-dependent processes by the Abl family of tyrosine kinases.
12764153 2003 Characterization of a myeloid tyrosine phosphatase, Lyp, and its role in the Bcr-Abl signal transduction pathway.
12672821 2003 Abl interactor 1 promotes tyrosine 296 phosphorylation of mammalian enabled (Mena) by c-Abl kinase.
12665579 2003 Caspase-dependent cleavage of c-Abl contributes to apoptosis.
12663457 2003 Presence of the BCR-ABL mutation Glu255Lys prior to STI571 (imatinib) treatment in patients with Ph+ acute lymphoblastic leukemia.
12654251 2003 Structural basis for the autoinhibition of c-Abl tyrosine kinase.
12654250 2003 A myristoyl/phosphotyrosine switch regulates c-Abl.
12650908 2003 Ionizing radiation-induced Rad51 nuclear focus formation is cell cycle-regulated and defective in both ATM(-/-) and c-Abl(-/-) cells.
12637538 2003 Tyrosine phosphorylation of protein kinase D in the pleckstrin homology domain leads to activation.
12626632 2003 Abl family nonreceptor tyrosine kinases modulate short-term synaptic plasticity.
12623848 2003 Detection of BCR-ABL mutations in patients with CML treated with imatinib is virtually always accompanied by clinical resistance, and mutations in the ATP phosphate-binding loop (P-loop) are associated with a poor prognosis.
12573241 2003 Identification of phosphorylation sites within the SH3 domains of Tec family tyrosine kinases.
12569093 2003 Functional interaction between the c-Abl and Arg protein-tyrosine kinases in the oxidative stress response.
12560071 2003 BCR-ABL binds to IRS-1 and IRS-1 phosphorylation is inhibited by imatinib in K562 cells.
12556557 2003 Direct evidence that Bcr-Abl tyrosine kinase activity disrupts normal synergistic interactions between Kit ligand and cytokines in primary primitive progenitor cells.
12531427 2003 c-Abl is required for oxidative stress-induced phosphorylation of caveolin-1 on tyrosine 14.
12525554 2003 Deletion in the ABL gene resulting from a meiotic recombination of a maternal (3;22;9)(q22;q12;q34.1) translocation.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
12505259 2002 Chronic myelocytic leukemia with eosinophilia, t(9;12)(q34;p13), and ETV6-ABL gene rearrangement: case report and review of the literature.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475393 2003 Cbl-ArgBP2 complex mediates ubiquitination and degradation of c-Abl.
12468540 2003 The role of C-terminal tyrosine phosphorylation in the regulation of SHP-1 explored via expressed protein ligation.
12445832 2002 Phosphorylation of Bruton's tyrosine kinase by c-Abl.
12408765 2002 Clinical significance of dual color-dual fusion translocation fluorescence in situ hybridization in the detection of bcr/abl fusion gene.
12393636 2003 Dual-specific Src and Abl kinase inhibitors, PP1 and CGP76030, inhibit growth and survival of cells expressing imatinib mesylate-resistant Bcr-Abl kinases.
12384576 2002 Structure of a regulatory complex involving the Abl SH3 domain, the Crk SH2 domain, and a Crk-derived phosphopeptide.
12379650 2002 Regulation of ionizing radiation-induced Rad52 nuclear foci formation by c-Abl-mediated phosphorylation.
12374739 2002 Tr-kit-induced resumption of the cell cycle in mouse eggs requires activation of a Src-like kinase.
12374288 2002 The Abl family kinases: mechanisms of regulation and signaling.
12220663 2002 The expression of the non-receptor tyrosine kinases Arg and c-abl is differently modulated in B lymphoid cells at different stages of differentiation.
12198159 2002 Tyrosine 221 in Crk regulates adhesion-dependent membrane localization of Crk and Rac and activation of Rac signaling.
12149456 2002 Clinical resistance to the kinase inhibitor STI-571 in chronic myeloid leukemia by mutation of Tyr-253 in the Abl kinase domain P-loop.
12144533 2002 Comprehensive comparison of FISH, RT-PCR, and RQ-PCR for monitoring the BCR-ABL gene after hematopoietic stem cell transplantation in CML.
12138893 2002 Bcr-Abl is a "molecular switch" for the decision for growth and differentiation in hematopoietic stem cells.
12130516 2002 Several types of mutations of the Abl gene can be found in chronic myeloid leukemia patients resistant to STI571, and they can pre-exist to the onset of treatment.
12130510 2002 Functional involvement of Akt signaling downstream of Jak1 in v-Abl-induced activation of hematopoietic cells.
12110584 2002 Tyrosine phosphorylation of Mdm2 by c-Abl: implications for p53 regulation.
12024016 2002 Constitutive association of BRCA1 and c-Abl and its ATM-dependent disruption after irradiation.
12021275 2002 Aph2, a protein with a zf-DHHC motif, interacts with c-Abl and has pro-apoptotic activity.
11971963 2002 c-Abl tyrosine kinase regulates the human Rad9 checkpoint protein in response to DNA damage.
11956190 2002 Sphingosine 1-phosphate induces membrane ruffling and increases motility of human umbilical vein endothelial cells via vascular endothelial growth factor receptor and CrkII.
11955625 2002 ik3-2, a relative to ik3-1/cables, is associated with cdk3, cdk5, and c-abl.
11891774 2002 Brain armadillo protein delta-catenin interacts with Abl tyrosine kinase and modulates cellular morphogenesis in response to growth factors.
11853795 2002 BCR-ABL gene mutations in relation to clinical resistance of Philadelphia-chromosome-positive leukaemia to STI571: a prospective study.
11840343 2002 Regulation of p73 by c-Abl through the p38 MAP kinase pathway.
11781820 2001 Phosphorylation and structure-based functional studies reveal a positive and a negative role for the activation loop of the c-Abl tyrosine kinase.
11780146 2002 Structure of the Bcr-Abl oncoprotein oligomerization domain.
11779715 2002 Abl: mechanisms of regulation and activation.
11741929 2002 Phosphorylation-dependent interactions between ADAM15 cytoplasmic domain and Src family protein-tyrosine kinases.
11708318 2001 [Real time quantitative PCR].
11598012 2001 PKCbeta modulates antigen receptor signaling via regulation of Btk membrane localization.
11593427 2001 Involvement of Jak2 tyrosine phosphorylation in Bcr-Abl transformation.
11509666 2001 Targeting of the c-Abl tyrosine kinase to mitochondria in endoplasmic reticulum stress-induced apoptosis.
11494134 2001 Regulation of Cbl phosphorylation by the Abl tyrosine kinase and the Nck SH2/SH3 adaptor.
11494128 2001 Multiple signaling interactions of Abl and Arg kinases with the EphB2 receptor.
11423618 2001 Clinical resistance to STI-571 cancer therapy caused by BCR-ABL gene mutation or amplification.
11420673 2001 Specific association of Type I c-Abl with Ran GTPase in lipopolysaccharide-mediated differentiation.
11418237 2001 Isolation of hNap1BP which interacts with human Nap1 (NCKAP1) whose expression is down-regulated in Alzheimer's disease.
11390389 2001 c-Abl tyrosine kinase binds and phosphorylates phospholipid scramblase 1.
11380621 2001 Crk family adaptor proteins trans-activate c-Abl kinase.
11375976 2001 Telomeric protein Pin2/TRF1 as an important ATM target in response to double strand DNA breaks.
11374898 2001 Cloning, mapping, and characterization of the human sorbin and SH3 domain containing 1 (SORBS1) gene: a protein associated with c-Abl during insulin signaling in the hepatoma cell line Hep3B.
11350980 2001 Targeting of the c-Abl tyrosine kinase to mitochondria in the necrotic cell death response to oxidative stress.
11309382 2001 Inhibition of c-Abl tyrosine kinase activity by filamentous actin.
11279131 2001 The beta-amyloid precursor protein APP is tyrosine-phosphorylated in cells expressing a constitutively active form of the Abl protoncogene.
11278340 2001 Interaction of hematopoietic progenitor kinase 1 and c-Abl tyrosine kinase in response to genotoxic stress.
11266449 2001 Negative regulation of Ros receptor tyrosine kinase signaling. An epithelial function of the SH2 domain protein tyrosine phosphatase SHP-1.
11163214 2000 Cytoskeletal protein PSTPIP1 directs the PEST-type protein tyrosine phosphatase to the c-Abl kinase to mediate Abl dephosphorylation.
11121037 2000 Functional interaction between c-Abl and the p21-activated protein kinase gamma-PAK.
11120811 2000 The c-Abl tyrosine kinase is regulated downstream of the B cell antigen receptor and interacts with CD19.
11114745 2000 Regulation of cell death by the Abl tyrosine kinase.
11024037 2001 Regulation of Cbl molecular interactions by the co-receptor molecule CD43 in human T cells.
11021760 2000 Quality assurance in RT-PCR-based BCR/ABL diagnostics--results of an interlaboratory test and a standardization approach.
10988075 2000 Structural mechanism for STI-571 inhibition of abelson tyrosine kinase.
10970852 2000 Scar/WAVE-1, a Wiskott-Aldrich syndrome protein, assembles an actin-associated multi-kinase scaffold.
10945997 2000 cAMP-dependent protein kinase phosphorylation of EVL, a Mena/VASP relative, regulates its interaction with actin and SH3 domains.
10896159 2000 Cables links Cdk5 and c-Abl and facilitates Cdk5 tyrosine phosphorylation, kinase upregulation, and neurite outgrowth.
10892742 2000 Repulsive axon guidance: Abelson and Enabled play opposing roles downstream of the roundabout receptor.
10849448 2000 Transformation of myeloid leukemia cells to cytokine independence by Bcr-Abl is suppressed by kinase-defective Hck.
10777567 2000 Interaction of the N-methyl-D-aspartic acid receptor NR2D subunit with the c-Abl tyrosine kinase.
10713716 2000 c-Abl: activation and nuclear targets.
10713049 2000 Interaction between protein kinase C delta and the c-Abl tyrosine kinase in the cellular response to oxidative stress.
10708759 2000 Direct interaction of nerve growth factor receptor, TrkA, with non-receptor tyrosine kinase, c-Abl, through the activation loop.
10679771 2000 Association of the Abl tyrosine kinase with the Trk nerve growth factor receptor.
10637231 2000 A nuclear tyrosine phosphorylation circuit: c-Jun as an activator and substrate of c-Abl and JNK.
10635328 1999 TRANCE, a TNF family member, activates Akt/PKB through a signaling complex involving TRAF6 and c-Src.
10629029 2000 Stimulation of p53 DNA binding by c-Abl requires the p53 C terminus and tetramerization.
10574931 1999 Functional interaction between SHPTP1 and the Lyn tyrosine kinase in the apoptotic response to DNA damage.
10567556 1999 Characterization of a novel member of the DOK family that binds and modulates Abl signaling.
10518561 1999 Molecular cloning of a docking protein, BRDG1, that acts downstream of the Tec tyrosine kinase.
10488096 1999 SHP-1 regulates Lck-induced phosphatidylinositol 3-kinase phosphorylation and activity.
10455176 1999 Tyrosine phosphorylation of tub and its association with Src homology 2 domain-containing proteins implicate tub in intracellular signaling by insulin.
10391251 1999 p73 is regulated by tyrosine kinase c-Abl in the apoptotic response to DNA damage.
10391250 1999 Interaction of c-Abl and p73alpha and their collaboration to induce apoptosis.
10391249 1999 The tyrosine kinase c-Abl regulates p73 in apoptotic response to cisplatin-induced DNA damage.
10325413 1999 The DNA-binding domain of human c-Abl tyrosine kinase promotes the interaction of a HMG chromosomal protein with DNA.
10212258 1999 Radiation-induced assembly of Rad51 and Rad52 recombination complex requires ATM and c-Abl.
10194451 1999 A novel SH2-containing phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase (SHIP2) is constitutively tyrosine phosphorylated and associated with src homologous and collagen gene (SHC) in chronic myelogenous leukemia progenitor cells.
10187839 1999 Proline-rich motifs of the Na+/H+ exchanger 2 isoform. Binding of Src homology domain 3 and role in apical targeting in epithelia.
9949177 1999 GCKR links the Bcr-Abl oncogene and Ras to the stress-activated protein kinase pathway.
9798959 1998 Expression, localization and functional interactions of Ku70 subunit of DNA-PK in peripheral lymphocytes and Nalm-19 cells after irradiation.
9698566 1998 Crystal structure of the abl-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions.
9642287 1998 Phosphorylation of CrkII adaptor protein at tyrosine 221 by epidermal growth factor receptor.
9632734 1998 Activation of extracellular signal-regulated kinase 2 by a novel Abl-binding protein, ST5.
9603926 1998 Integrins regulate the association and phosphorylation of paxillin by c-Abl.
9593709 1998 Identification of a candidate human spectrin Src homology 3 domain-binding protein suggests a general mechanism of association of tyrosine kinases with the spectrin-based membrane skeleton.
9583676 1998 The kinase activity of c-Abl but not v-Abl is potentiated by direct interaction with RFXI, a protein that binds the enhancers of several viruses and cell-cycle regulated genes.
9516488 1998 Grb2 and its apoptotic isoform Grb3-3 associate with heterogeneous nuclear ribonucleoprotein C, and these interactions are modulated by poly(U) RNA.
9480911 1998 Interaction in vitro of the product of the c-Crk-II proto-oncogene with the insulin-like growth factor I receptor.
9461559 1998 Regulation of Rad51 function by c-Abl in response to DNA damage.
9407116 1997 The Src family kinase Hck interacts with Bcr-Abl by a kinase-independent mechanism and phosphorylates the Grb2-binding site of Bcr.
9356459 1997 The amphiphysin-like protein 1 (ALP1) interacts functionally with the cABL tyrosine kinase and may play a role in cytoskeletal regulation.
9346925 1997 SH2/SH3 adaptor proteins can link tyrosine kinases to a Ste20-related protein kinase, HPK1.
9334312 1997 The PAG gene product, a stress-induced protein with antioxidant properties, is an Abl SH3-binding protein and a physiological inhibitor of c-Abl tyrosine kinase activity.
9315092 1997 Identification and characterization of two novel SH2 domain-containing proteins from a yeast two hybrid screen with the ABL tyrosine kinase.
9312071 1997 Binding of Ku and c-Abl at the kinase homology region of DNA-dependent protein kinase catalytic subunit.
9211900 1997 ArgBP2, a multiple Src homology 3 domain-containing, Arg/Abl-interacting protein, is phosphorylated in v-Abl-transformed cells and localized in stress fibers and cardiocyte Z-disks.
9168117 1997 Interaction between ATM protein and c-Abl in response to DNA damage.
9168116 1997 Ataxia telangiectasia mutant protein activates c-Abl tyrosine kinase in response to ionizing radiation.
9144171 1997 Protein binding and signaling properties of RIN1 suggest a unique effector function.
9111318 1997 Activation of Jak2 catalytic activity requires phosphorylation of Y1007 in the kinase activation loop.
9067577 1997 The BCR/ABL oncogene alters interaction of the adapter proteins CRKL and CRK with cellular proteins.
9037071 1997 Regulation of DNA damage-induced apoptosis by the c-Abl tyrosine kinase.
9010225 1997 Isolation and characterization of e3B1, an eps8 binding protein that regulates cell growth.
8943360 1996 c-ABL tyrosine kinase activity is regulated by association with a novel SH3-domain-binding protein.
8879209 1996 Structure and function of Cas-L, a 105-kD Crk-associated substrate-related protein that is involved in beta 1 integrin-mediated signaling in lymphocytes.
8875975 1996 Proline-rich sequences mediate the interaction of the Arg protein tyrosine kinase with Crk.
8692915 1996 The stress response to ionizing radiation involoves c-Abl-dependent phosphorylation of SHPTP1.
8668151 1996 Identification of a binding site in c-Ab1 tyrosine kinase for the C-terminal repeated domain of RNA polymerase II.
8668148 1996 Human enhancer of filamentation 1, a novel p130cas-like docking protein, associates with focal adhesion kinase and induces pseudohyphal growth in Saccharomyces cerevisiae.
8630736 1996 Regulation of Btk function by a major autophosphorylation site within the SH3 domain.
8629002 1996 Activation of BTK by a phosphorylation mechanism initiated by SRC family kinases.
8590002 1995 The solution structure of Abl SH3, and its relationship to SH2 in the SH(32) construct.
8453102 1993 Duplication of small segments within the major breakpoint cluster region in chronic myelogenous leukemia.
8438166 1993 Identification of a ten-amino acid proline-rich SH3 binding site.
8242749 1993 A C-terminal protein-binding domain in the retinoblastoma protein regulates nuclear c-Abl tyrosine kinase in the cell cycle.
8194526 1994 c-Abl kinase regulates the protein binding activity of c-Crk.
8114715 1994 Lck-dependent tyrosyl phosphorylation of the phosphotyrosine phosphatase SH-PTP1 in murine T cells.
7892170 1994 Homology modeling of the Abl-SH3 domain.
7828850 1995 Disruption of retinoblastoma protein function by coexpression of its C pocket fragment.
7780740 1995 Evidence that SH2 domains promote processive phosphorylation by protein-tyrosine kinases.
7760813 1995 Binding of ZAP-70 to phosphorylated T-cell receptor zeta and eta enhances its autophosphorylation and generates specific binding sites for SH2 domain-containing proteins.
7665185 1995 Sequence and analysis of the human ABL gene, the BCR gene, and regions involved in the Philadelphia chromosomal translocation.
7590236 1995 Abi-2, a novel SH3-containing protein interacts with the c-Abl tyrosine kinase and modulates c-Abl transforming activity.
7545908 1994 Sequence analysis of the mutation at codon 834 and the sequence variation of codon 837 of c-abl gene.
7533294 1995 Src homology 2 domain as a specificity determinant in the c-Abl-mediated tyrosine phosphorylation of the RNA polymerase II carboxyl-terminal repeated domain.
7512963 1994 Insulin stimulates the phosphorylation of Tyr538 and the catalytic activity of PTP1C, a protein tyrosine phosphatase with Src homology-2 domains.
7493940 1995 CRKL links p210BCR/ABL with paxillin in chronic myelogenous leukemia cells.
6323103 1984 Localization of the cellular oncogenes ABL, SIS, and FES on human germ-line chromosomes.
6319012 1984 Philadelphia chromosomal breakpoints are clustered within a limited region, bcr, on chromosome 22.
6316147 1983 Localization of the c-ab1 oncogene adjacent to a translocation break point in chronic myelocytic leukaemia.
6302194 1983 The human v-abl cellular homologue.
6281890 1982 Isolation of human oncogene sequences (v-fes homolog) from a cosmid library.
6191223 1983 Homology between phosphotyrosine acceptor site of human c-abl and viral oncogene products.
4062888 1985 Isolation of complement-fragment-iC3b-binding proteins by affinity chromatography. The identification of p150,95 as an iC3b-binding protein.
3471171 1986 The role of the Philadelphia translocation in chronic myelocytic leukemia.
3313010 1987 The first intron in the human c-abl gene is at least 200 kilobases long and is a target for translocations in chronic myelogenous leukemia.
3023859 1986 The chronic myelocytic cell line K562 contains a breakpoint in bcr and produces a chimeric bcr/c-abl transcript.
3021337 1986 Alternative splicing of RNAs transcribed from the human abl gene and from the bcr-abl fused gene.
2989703 1985 Structural organization of the bcr gene and its role in the Ph' translocation.
2989692 1985 Fused transcript of abl and bcr genes in chronic myelogenous leukaemia.
2825022 1987 A new fused transcript in Philadelphia chromosome positive acute lymphocytic leukaemia.
2687768 1989 Nucleotide sequence analysis of human abl and bcr-abl cDNAs.
2678002 1989 Structural alterations of the BCR and ABL genes in Ph1 positive acute leukemias with rearrangements in the BCR gene first intron: further evidence implicating Alu sequences in the chromosome translocation.
2542016 1989 N-terminal mutations activate the leukemogenic potential of the myristoylated form of c-abl.
2193202 1990 A novel variant of the bcr-abl fusion product in Philadelphia chromosome-positive acute lymphoblastic leukemia.
2183353 1990 Differential phosphorylation of c-Abl in cell cycle determined by cdc2 kinase and phosphatase activity.
2179820 1990 Cloning and sequencing of the human c-abl 3' untranslated region.
2163052 1990 Characterization of the human ABL promoter regions.
1868241 1991 Entire ABL gene is joined with 5'-BCR in some patients with Philadelphia-positive leukemia.
1857987 1991 Selective inhibition of leukemia cell proliferation by BCR-ABL antisense oligodeoxynucleotides.
1538749 1992 Sequence identification of 2,375 human brain genes.
1505033 1992 Three-dimensional solution structure of the src homology 2 domain of c-abl.
1383690 1992 A limited set of SH2 domains binds BCR through a high-affinity phosphotyrosine-independent interaction.
1379745 1992 Identification of a protein that binds to the SH3 region of Abl and is similar to Bcr and GAP-rho.
1281542 1992 Secondary structure of Src homology 2 domain of c-Abl by heteronuclear NMR spectroscopy in solution.