Property Summary

Ligand Count 636
NCBI Gene PubMed Count 663
PubMed Score 3418.51
PubTator Score 4611.85

Knowledge Summary

Patent (329,475)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Cancer 2499 6.589 3.3
Disease Target Count Z-score Confidence
Polycythemia vera 27 5.28 2.6
Hypereosinophilic syndrome 71 3.149 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 2.100 6.6e-04
atypical teratoid / rhabdoid tumor 1.100 2.9e-05
Down syndrome 1.200 5.3e-04
ependymoma 1.200 1.5e-02
group 3 medulloblastoma 1.100 1.9e-04
juvenile dermatomyositis 1.147 9.4e-13
osteosarcoma 1.123 1.8e-02
ovarian cancer -1.400 1.2e-06
pancreatic cancer 1.100 3.3e-02
primary pancreatic ductal adenocarcinoma 1.164 4.8e-02
tuberculosis -1.200 1.9e-07

Synonym

Accession P00519 A3KFJ3 Q13869 Q13870 Q16133 Q17R61 Q45F09
Symbols ABL
JTK7
p150
c-ABL
v-abl
CHDSKM
c-ABL1
bcr/abl

Gene

Protein-protein Interaction (1)

PDB (61)

Gene RIF (465)

AA Sequence

MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALY      1 - 70
DFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYL     71 - 140
LSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLI    141 - 210
TTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEV    211 - 280
EEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSA    281 - 350
MEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS    351 - 420
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIH    421 - 490
QAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESD    491 - 560
PLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPER    561 - 630
RGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLAT    631 - 700
GEEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGEN    701 - 770
RSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS    771 - 840
ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKA    841 - 910
GGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAP    911 - 980
VPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQM    981 - 1050
ASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSS   1051 - 1120
VKEISDIVQR                                                               1121 - 1130
//

Text Mined References (696)

PMID Year Title