Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.16
PubTator Score 9.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (35)

Disease log2 FC p
astrocytic glioma 2.500 3.5e-03
posterior fossa group A ependymoma 3.100 3.6e-09
cystic fibrosis 2.442 1.7e-06
Duchenne muscular dystrophy 2.161 3.9e-07
limb girdle muscular dystrophy 2A 1.411 9.4e-03
autosomal dominant Emery-Dreifuss muscul... 1.788 1.2e-02
fascioscapulohumeral muscular dystrophy 1.293 2.0e-04
juvenile dermatomyositis 1.923 6.4e-09
acute quadriplegic myopathy 1.338 5.6e-03
primary pancreatic ductal adenocarcinoma 2.825 7.0e-05
non-small cell lung cancer -3.290 6.6e-24
intraductal papillary-mucinous adenoma (... -2.400 1.7e-02
intraductal papillary-mucinous carcinoma... -4.700 9.2e-05
intraductal papillary-mucinous neoplasm ... -3.500 1.6e-02
lung cancer -2.600 1.1e-04
colon cancer -2.000 1.5e-06
sarcoidosis 1.300 2.9e-02
fibroadenoma -1.300 1.2e-02
lung adenocarcinoma -1.900 1.1e-11
adult high grade glioma 1.500 3.9e-02
group 4 medulloblastoma -1.600 1.4e-03
pilocytic astrocytoma 1.700 1.7e-03
primary Sjogren syndrome 1.300 1.4e-03
nasopharyngeal carcinoma -1.800 3.7e-02
psoriasis -1.100 3.4e-08
lung carcinoma -2.900 1.4e-12
breast carcinoma -1.600 3.4e-16
spina bifida -1.275 4.1e-02
Breast cancer -2.100 1.6e-07
ductal carcinoma in situ -1.200 4.1e-02
invasive ductal carcinoma -2.800 2.0e-02
ovarian cancer -5.000 1.2e-12
pituitary cancer -1.700 5.5e-03
pancreatic cancer 2.500 1.3e-03
head and neck cancer -1.600 2.1e-02

Gene RIF (7)

PMID Text
24442417 ABI3BP is a susceptibility gene for Kashin-Beck disease in the Chinese Han population.
21041247 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19338757 These results suggest that TARSH plays an important role in proliferation of replicative senescence and may serve as a trigger of tumor development.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18559958 The loss of ABI3BP expression could play a functional role in thyroid tumorigenesis.
16205947 expression of TARSH mRNA is remarkably downregulated in all lung cancer cell lines examined; also TARSH expression was significantly low in all of the tumor specimens when compared to the expression in corresponding non-neoplastic lung tissue specimens
15752759 Thus, TARSH presumably represents a trigger gene for evoking cellular senescence, which has also been suggested to be involved in the prevention of tumorigenesis.

AA Sequence

MRGGKCNMLSSLGCLLLCGSITLALGNAQKLPKGKRPNLKVHINTTSDSILLKFLRPSPNVKLEGLLLGY      1 - 70
GSNVSPNQYFPLPAEGKFTEAIVDAEPKYLIVVRPAPPPSQKKSCSGKTRSRKPLQLVVGTLTPSSVFLS     71 - 140
WGFLINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQICPATETIVENLKPNTVYEFGVKDNVEGGIW    141 - 210
SKIFNHKTVVGSKKVNGKIQSTYDQDHTVPAYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILV    211 - 280
HLIIPGLNETTVKLPASLMFEISDALKTQLAKNETLALPAESKTPEVEKISARPTTVTPETVPRSTKPTT    281 - 350
SSALDVSETTLASSEKPWIVPTAKISEDSKVLQPQTATYDVFSSPTTSDEPEISDSYTATSDRILDSIPP    351 - 420
KTSRTLEQPRATLAPSETPFVPQKLEIFTSPEMQPTTPAPQQTTSIPSTPKRRPRPKPPRTKPERTTSAG    421 - 490
TITPKISKSPEPTWTTPAPGKTQFISLKPKIPLSPEVTHTKPAPKQTPRAPPKPKTSPRPRIPQTQPVPK    491 - 560
VPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQSEPAPLETRGIPFIPMISPSPSQEELQTTLE    561 - 630
ETDQSTQEPFTTKIPRTTELAKTTQAPHRFYTTVRPRTSDKPHIRPGVKQAPRPSGADRNVSVDSTHPTK    631 - 700
KPGTRRPPLPPRPTHPRRKPLPPNNVTGKPGSAGIISSGPITTPPLRSTPRPTGTPLERIETDIKQPTVP    701 - 770
ASGEELENITDFSSSPTRETDPLGKPRFKGPHVRYIQKPDNSPCSITDSVKRFPKEEATEGNATSPPQNP    771 - 840
PTNLTVVTVEGCPSFVILDWEKPLNDTVTEYEVISRENGSFSGKNKSIQMTNQTFSTVENLKPNTSYEFQ    841 - 910
VKPKNPLGEGPVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYSECKGKQYVKRTWYKKFVGVQ    911 - 980
LCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFLDGRTGQQLTSDQLPIKEGYFRAVRQEPVQF    981 - 1050
GEIGGHTQINYVQWYECGTTIPGKW                                                1051 - 1075
//

Text Mined References (17)

PMID Year Title
24442417 2014 Genome-wide copy number variation study and gene expression analysis identify ABI3BP as a susceptibility gene for Kashin-Beck disease.
24236485 2013 Genome-wide association study in NSAID-induced acute urticaria/angioedema in Spanish and Han Chinese populations.
23829686 2013 Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations.
21041247 2010 Genome-wide association study of suicide attempts in mood disorder patients.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19338757 2009 Implication of p53-dependent cellular senescence related gene, TARSH in tumor suppression.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18559958 2008 Re-expression of ABI3-binding protein suppresses thyroid tumor growth by promoting senescence and inhibiting invasion.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16205947 2006 Cancer-associated loss of TARSH gene expression in human primary lung cancer.
15752759 2005 Expression of TARSH gene in MEFs senescence and its potential implication in human lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11501947 2001 Cloning and sequencing of a novel human gene that encodes a putative target protein of Nesh-SH3.