Property Summary

NCBI Gene PubMed Count 20
PubMed Score 72.07
PubTator Score 23.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
21223585 Result links ABI3 to the pathogenesis and progression of some cancers and suggests that ABI3 or its pathway might have interest as therapeutic target.
17101133 NESH (Abi-3), like Abi-1 and Abi-2, is a component of the Abi/WAVE complex, but likely plays a different role in the regulation of c-Abl.
11956071 Forced expression of NESH suppresses motility and metastatic dissemination of malignant cells.

AA Sequence

MAELQQLQEFEIPTGREALRGNHSALLRVADYCEDNYVQATDKRKALEETMAFTTQALASVAYQVGNLAG      1 - 70
HTLRMLDLQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAPENLPPLTPYCRRP     71 - 140
LNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATPASATLGRPPRIPEPVHLPVVPDGRLSAASSAFS    141 - 210
LASAGSAEGVGGAPTPKGQAAPPAPPLPSSLDPPPPPAAVEVFQRPPTLEELSPPPPDEELPLPLDLPPP    211 - 280
PPLDGDELGLPPPPPGFGPDEPSWVPASYLEKVVTLYPYTSQKDNELSFSEGTVICVTRRYSDGWCEGVS    281 - 350
SEGTGFFPGNYVEPSC                                                          351 - 366
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21223585 2011 ABI3 ectopic expression reduces in vitro and in vivo cell growth properties while inducing senescence.
19946888 2010 Defining the membrane proteome of NK cells.
19060904 2009 An empirical framework for binary interactome mapping.
17101133 2006 NESH (Abi-3) is present in the Abi/WAVE complex but does not promote c-Abl-mediated phosphorylation.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12011975 2002 In search of a function for the E3B1/Abi2/Argbp1/NESH family (Review).
11956071 2002 Forced expression of NESH suppresses motility and metastatic dissemination of malignant cells.
11501947 2001 Cloning and sequencing of a novel human gene that encodes a putative target protein of Nesh-SH3.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10978530 2000 Isolation and characterization of a novel human gene (NESH) which encodes a putative signaling molecule similar to e3B1 protein.