Property Summary

NCBI Gene PubMed Count 14
PubMed Score 26.14
PubTator Score 15.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active ulcerative colitis -1.050 1.9e-02
adult high grade glioma -1.200 2.3e-04
atypical teratoid / rhabdoid tumor -1.200 3.4e-03
breast carcinoma -1.200 1.5e-03
glioblastoma -1.100 1.4e-02
intraductal papillary-mucinous adenoma (... 1.100 3.5e-04
invasive ductal carcinoma -1.100 8.9e-03
lung adenocarcinoma -1.200 1.4e-11
malignant mesothelioma -1.600 1.4e-06
medulloblastoma, large-cell -1.500 7.6e-04
nasopharyngeal carcinoma -1.200 1.3e-07
non-small cell lung cancer -1.003 5.1e-16
osteosarcoma -1.406 5.6e-04
ovarian cancer -1.200 4.1e-08
pancreatic ductal adenocarcinoma liver m... -2.504 7.2e-04
Pick disease -1.200 7.9e-04
primitive neuroectodermal tumor -1.100 3.4e-05
psoriasis -1.200 5.7e-07
Rheumatoid arthritis -1.100 2.2e-02
subependymal giant cell astrocytoma -2.199 1.4e-02
tuberculosis -1.200 6.2e-04

Gene RIF (7)

AA Sequence

MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGH      1 - 70
KPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKK     71 - 140
PFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEM    141 - 210
SEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQV    211 - 280
LDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD                 281 - 337
//

Text Mined References (15)

PMID Year Title