Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.71
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Neutral lipid storage disease 12 4.654 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.300 4.1e-06
lung cancer 1.200 2.6e-02
oligodendroglioma 1.100 2.9e-03
posterior fossa group A ependymoma 1.100 8.7e-11
subependymal giant cell astrocytoma 1.277 6.6e-03

Gene RIF (2)

AA Sequence

MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTP      1 - 70
LVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSM     71 - 140
ILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVA    141 - 210
GPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKD    211 - 280
VPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD            281 - 342
//

Text Mined References (7)

PMID Year Title