Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.40
PubTator Score 11.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.411 3.2e-03
atypical teratoid / rhabdoid tumor 1.600 3.7e-06
glioblastoma 1.500 2.2e-04
medulloblastoma, large-cell 2.200 4.6e-05
pancreatic ductal adenocarcinoma liver m... -1.035 1.2e-03
adult high grade glioma 1.200 2.0e-03
pilocytic astrocytoma 1.400 4.0e-07
inflammatory breast cancer -1.300 2.4e-04
invasive ductal carcinoma -1.500 3.5e-03

 GO Function (1)

AA Sequence

MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLP      1 - 70
GLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTD     71 - 140
KINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ    141 - 210
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14672934 2004 The crystal structure of CCG1/TAF(II)250-interacting factor B (CIB).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11053859 2000 Purification, crystallization and preliminary X-ray crystallographic analysis of human CCG1-interacting factor B.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.