Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.52
PubTator Score 0.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.500 8.3e-06
atypical teratoid / rhabdoid tumor -1.700 2.9e-09
glioblastoma -1.100 1.2e-05
group 3 medulloblastoma 1.100 3.9e-03
pituitary cancer 1.500 3.6e-06
subependymal giant cell astrocytoma -1.371 2.2e-02
tuberculosis 1.100 2.3e-07

Gene RIF (1)

AA Sequence

MVGALCGCWFRLGGARPLIPLGPTVVQTSMSRSQVALLGLSLLLMLLLYVGLPGPPEQTSCLWGDPNVTV      1 - 70
LAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTLQLLSQRGYRAVALDLPGFGNSAPS     71 - 140
KEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQNYTQEQFWAV    141 - 210
KTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP             211 - 271
//

Text Mined References (8)

PMID Year Title