Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 8.3e-20
tuberculosis and treatment for 3 months 179 1.0e-03
Rheumatoid arthritis 1191 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer -1.400 8.3e-20
Rheumatoid arthritis 1.100 4.2e-02
tuberculosis and treatment for 3 months 1.100 1.0e-03

Gene RIF (1)

AA Sequence

MEKSWMLWNFVERWLIALASWSWALCRISLLPLIVTFHLYGGIILLLLIFISIAGILYKFQDVLLYFPEQ      1 - 70
PSSSRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGNAGNIGHRLPNALLMLVN     71 - 140
LKVNLLLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKIFLFGRSLGGAVAIHLASENSHRI    141 - 210
SAIMVENTFLSIPHMASTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLY    211 - 280
ELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII                 281 - 337
//

Text Mined References (8)

PMID Year Title