Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.68
PubTator Score 0.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma -1.400 4.7e-10
group 3 medulloblastoma -1.400 2.8e-02
atypical teratoid/rhabdoid tumor -1.300 4.0e-05
primitive neuroectodermal tumor -1.200 4.2e-02
Atopic dermatitis -2.900 3.8e-05
psoriasis -1.600 1.9e-52
ovarian cancer -2.200 1.2e-15

AA Sequence

MDAQDCQAAASPEPPGPPARSCVAAWWDMVDRNLRYFPHSCSMLGRKIAALYDSFTSKSLKEHVFLPLID      1 - 70
MLIYFNFFKAPFLVDLKKPELKIPHTVNFYLRVEPGVMLGIWHTVPSCRGEDAKGKDCCWYEAALRDGNP     71 - 140
IIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGLTTDAICVYEWTKARSGITP    141 - 210
VCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDK    211 - 280
IIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLL    281 - 350
ITVRDFLSKQWS                                                              351 - 362
//

Text Mined References (6)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.