Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.74
PubTator Score 3.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q8NFV4 H7BYM8 Q6PJU0 Q8N722 Q8N723 Q8NFV2 Q8NFV3 Q9HBS8
Symbols PP1226
WBSCR21

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (4)

AA Sequence

MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEPRPLPLSYRLLDGEAALPAVV      1 - 70
FLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGH     71 - 140
SMGGKTAMLLALQRPELVERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLSSVI    141 - 210
QDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIM    211 - 280
RLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV                                       281 - 315
//

Text Mined References (14)

PMID Year Title