Property Summary

NCBI Gene PubMed Count 105
PubMed Score 264.04
PubTator Score 127.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.009 1.4e-03
pancreatic ductal adenocarcinoma liver m... -1.595 6.1e-04
psoriasis -1.200 4.1e-04

Protein-protein Interaction (5)

Gene RIF (118)

PMID Text
27144356 crystallization in lipid bilayers to determine the X-ray structure of human G5G8 in a nucleotide-free state at 3.9 A resolution, generating the first atomic model of an ABC sterol transporter
26088706 Genetic polymorphism within the ABCG8 gene is a risk factor for diabetes.
25804128 A polymorphism of the sterol transporter ABCG8 has been associated with the prevalence of end-stage renal disease
25056759 Mutation in ABCG8 is associated with sitosterolaemia.
24811295 Sitosterolemia is caused by a genetic defect of sterolins (ABCG5/ABCG8) mapped to the STSL locus. Polymorphic variations in STSL have been linked to lipid levels and gallstone disease
24691589 ABCG5/8 variants are associated with susceptibility to coronary heart disease.
24657701 MI and gallstones, 2 seemingly unrelated diseases, are intrinsically linked via the function of the ABCG5/8 cholesterol transporter.
24584735 HRD1 and RMA1 may therefore be negative regulators of disease-associated transporter ABCG5/ABCG8.
24252657 ATP-binding cassette (ABC) transporters G5 (ABCG5) and G8 (ABCG8) form an obligate heterodimer that limits intestinal absorption and facilitates biliary secretion of cholesterol and phytosterols.
23840693 A single nucleotide polymorphism of ABCG8 is associated with fasting plasma glucose levels in a cross-sectional study but do not predict hyperglycemia or incident type 2 diabetes. [meta-analysis]
23790976 The evolutionary conserved region of ABCG8 were found to be responsive to the Liver-X-Receptor.
23707316 ABCG8 (and ABO) variants are associated with high intestinal cholesterol absorption and cardiovascular disease.
23406058 Both gallstone disease and p.D19H of ABCG8 are associated with diminished cholesterol absorption.
23241408 G574R variant is associated with moderately elevated plant sterol levels in Old Order Amish. Carriers of the 574R allele had modestly lower levels of carotid wall thickness compared with noncarriers.
23179156 The sterol transporters ABCA1, ABCG5, and ABCG8 may play a role in the pathogenesis of human cholesterol related gallbladder diseases.
22898925 ABCG8-D19H variant associated with cholesterol gallstone disease
22869156 Recurrence of gallstones after cholecystectomy is associated with ABCG8 genotype.
22655090 The associations of four ABCG5/G8 single nucleotide polymorphisms and serum lipid levels are different between the Mulao and Han populations in China, or between males and females.
22548731 The ABCG8 rs4148217 SNP is associated with serum TG, HDL-C and ApoA1 levels in our study populations, but this association is different between the Mulao and Han populations.
22378727 Data suggest that ABCG8 S107X heterozygous mutation affects plasma phytosterol levels but not cholesterol metabolism (i.e., intestinal absorption, biosynthesis). Mutation affects efficacy of phytosterols supplementation on cholesterol absorption.
21274884 ABCG8 D19H genotype was an important predictor of both symptomatic gallstone disease and biliary cancer.
21062971 ABCG8 rs11887534, identified as a gallstone risk single-nucleotide polymorphism by whole genome scan, is also associated with an increased risk of biliary tract cancer
21062971 Observational study of gene-disease association. (HuGE Navigator)
21039838 In the present study, we observed a highly significant association of the ABCG8 DH genotype and H allele with gallstone susceptibility in the northern Indian population.
21039838 Observational study of gene-disease association. (HuGE Navigator)
20854103 Associations of 4 common ABCG8 polymorphisms (D19H, Y54C, T400K, and A632V)with ischemic stroke and coronary artery disease were sought. There was a tendency toward reduced 54YY-genotype frequency among male patients under 50 years of age with stroke.
20854103 Observational study of gene-disease association. (HuGE Navigator)
20837016 Variants of ABCG8 and UGT1A1 are the 2 major risk factors for overall gallstone disease, they contribute a population attributable risk of 21.2% among men
20679960 Observational study of gene-disease association. (HuGE Navigator)
20594224 SNP D19H, but not SNP T400K, in the ABCG8 gene is significantly associated with GSD in an Indian population.
20594224 Observational study of gene-disease association. (HuGE Navigator)
20592455 Genetic variant 19H of ABCG8 is associated with coronary artery disease.
20592455 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20581104 A systematic review and meta-analysis of ABCG8 polymorphisms and association with markers of cholesterol metabolism.
20529992 Common variants in ABCG8 and ABO are strongly associated with serum phytosterol levels and show concordant and previously unknown associations with coronary heart disease.
20529992 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20497293 Twins carrying a heterozygous or homozygous ABCG8 D19H genotype have a significantly increased risk of gallstone disease.
20497293 Observational study of gene-disease association. (HuGE Navigator)
20413122 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20370913 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20235787 strong association of sequence variants of HMGCR, SREBF1 and ABCG8 genes with the reduction of LDL-C after statin treatment in a Chinese population
20235787 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20210363 Bile acids may promote an active conformation of purified ABCG5/G8 either by global stabilization of the transporter or by binding to a specific site on ABCG5/G8.
20172523 Genetic variations at ABCG5/G8 genes modulate plasma lipids concentrations in patients with familial hypercholesterolemia
20172523 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20170916 For the ABCG8 gene, the rs4148211 polymorphism was associated with higher plasma total cholesterol and LDLcholesterol concentrations in the total population.
20170916 Observational study of gene-disease association. (HuGE Navigator)
20163776 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19692220 The effects of ABCG5/G8 polymorphisms on HDL-cholesterol concentrations depend on ABCA1 genetic variants.
19692220 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19306529 Insulin resistance elevates ABCG8 and increases susceptibility to cholesterol gallstones
19270375 To examine the molecular mechanisms of the regulated trafficking of ABCG5 and ABCG8, the subcellular localizations of chimeric proteins, fused with ABCG1 or ABCG2, were analyzed.
19217458 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19111681 Most Asian phytosterolemia patients possess mutations in the ABCG5 gene. The site of the novel mutation was completely different from previous reports. No other mutation was found in the ABCG5 and ABCG8 genes.
19060906 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19019257 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19018975 The DH genotype and the H allele of the ABCG8 D19H polymorphism are associated with Gallbladder cancer susceptibility.
19018975 Observational study of gene-disease association. (HuGE Navigator)
19012522 In Chilean patients, the ABCG5 1950C>G polymorphism, but not the ABCG8 251A>G polymorphism, was found to be associated with hypercholesterolemia.
19012522 Observational study of gene-disease association. (HuGE Navigator)
19005228 ABCG5/G8 genetic variants modulate HDL-C concentrations, leading to an HDL-C-lowering effect and thereby a potential increased risk for atherosclerosis only in smokers.
18977479 Genetic variation in the ABCG8 gene may influence the burden of atherosclerosis in familial hypercholesteremia.
18977479 Observational study of gene-disease association. (HuGE Navigator)
18850127 Results describe the association between ABCG5/G8 and NPC1L1 genotype single nucleotide polymorphisms with sterol absorption and corresponding plasma concentrations.
18850127 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18641716 No common polymorphisms in ABCG8, ABCG5, or NPC1L1 were demonstrated between the 3 top responders and the non-respondersto plant sterol intervention.
18641716 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18581044 Coexistence of higher insulin resistance and hypercholesterolemia for carriers of the aspartate-19-histidine polymorphism may result in a greater risk of cardiovascular disease.
18581044 Observational study of gene-disease association. (HuGE Navigator)
18522623 links between polymorphisms of ABC G8A (ABCG8) transporter gene to hypercholesterolemia and to gallstone disease risk (Review)
18457353 Carriers of ABCG5 604Q or ABCG8 D19H polymorphisms have an increased risk of gallstone disease independent of age, sex and body mass index.
18457353 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18007013 Upregulation of ABCG5/ABCG8 in gallstone patients, possibly mediated by increased liver X receptor alpha, may contribute to the cholesterol supersaturation of bile, a prerequisite for gallstone formation.
17827468 Single nucleotide polymorphisms in ABCG8 are associated with changes in cholesterol metabolism during weight loss
17827468 Observational study of gene-disease association. (HuGE Navigator)
17690481 results indicate that ABCG5/G8, unlike ABCA1, together with bile acids should participate in sterol efflux on the apical surface of Caco-2 cells.
17632509 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17632509 An association scan of >500,000 SNPs in individuals with gallstones and controls was performed; a follow-up study of the 235 most significant SNPs in affected individuals and controls replicated the disease association of SNP A-1791411 in ABCG8.
17626266 Observational study of gene-disease association. (HuGE Navigator)
17626266 The results of the genetic study taken together indicate that in gallstone-susceptible carriers of the ABCG8 19H allele, cholesterol cholelithiasis is secondary to increased hepatobiliary cholesterol secretion.
17612515 Observational study of gene-disease association. (HuGE Navigator)
17612515 These findings indicate that the T400K polymorphism in ABCG8 may be associated with the incidence of gallstone disease in males.
17403900 Cooperative interaction between HNF4A and GATA4 and GATA6 regulates ABCG5 and ABCG8.
17102949 Increased NPC1L1 and lower ABCG5 abd ABCG8 may lead to increased cholesterol and sitosterol in chylomicron particles in diabetic patients.
17098593 Observational study of gene-disease association. (HuGE Navigator)
17055487 biochemical and functional characterization of the ABCG5/ABCG8 proteins and their possible involvement in steroid hormone transport or regulation.
16980816 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16980816 Polymorphisms at the half-transporter ABCG5 and ABCG8 genes affect blood cholesterol concentrations in prepubertal children by influencing dietary responsiveness.
16893193 Purified ABCG5 and ABCG8 had very low ATPase activities, suggesting that the hetero-dimer is the catalytically active species, and likely the active species in vivo.
16518588 In diabetic patients statin therapy is associated wiwth increased mRNA.
16472606 Two genes, ABCG5 and ABCG8, compose the sitosterolemia locus, and complete mutation in either, but not both, results in disease.
15930516 MDR2 expression is required for ABCG5- and ABCG8-mediated biliary sterol secretion. Inactivation of MDR2 markedly attenuated the reduction in fractional sterol absorption associated with ABCG5, ABCG8 overexpression
15816807 Observational study of gene-disease association. (HuGE Navigator)
15611112 ABCGG5 and ABCG8 are required to modulate biliary cholesterol secretion in response to cholate and diosgenin.
15520451 Observational study of gene-disease association. (HuGE Navigator)
15331430 Observational study of gene-disease association. (HuGE Navigator)
15311998 Observational study of gene-disease association. (HuGE Navigator)
15311998 Genetic variations in the ABCG8 gene may play a role in the genetic determination of plasma cholesterol levels and could possibly influence the gender-specific response of plasma cholesterol levels after dietary changes.
15262185 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15175352 Observational study of gene-disease association. (HuGE Navigator)
14703505 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14703505 in patients with hypercholesterolemia, the ABCG8 D19H variant is associated with greater LDLC-lowering response to atorvastatin therapy
14504269 ABCG5 and ABCG8 function as obligate heterodimers to promote sterol excretion into bile
12220438 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12208868 Role of ABCG5 and ABCG8 in cholesterol secretion and absorption
12150943 several potential regulatory elements were found for the ABCG5 and ABCG8 genes, and the intergenic region was found to act as a bidirectional promoter
12124998 In a sitosterolemia patient a novel heterozygous mutation has been found in exon 5 of ABCG8 (c.584T>A; Leu195Gln).
11893785 Common DNA sequence polymorphisms in the ABCG8 gene contribute to heritable variation in the plasma concentrations of the plant sterols campesterol and sitosterol.
11668628 mutations in ATP-binding cassette proteins G5 (ABCG5) and G8 (ABCG8) causing sitosterolemia

AA Sequence

MAGKAAEERGLPKGATPQDTSGLQDRLFSSESDNSLYFTYSGQPNTLEVRDLNYQVDLASQVPWFEQLAQ      1 - 70
FKMPWTSPSCQNSCELGIQNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKIKSGQIWINGQPSS     71 - 140
PQLVRKCVAHVRQHNQLLPNLTVRETLAFIAQMRLPRTFSQAQRDKRVEDVIAELRLRQCADTRVGNMYV    141 - 210
RGLSGGERRRVSIGVQLLWNPGILILDEPTSGLDSFTAHNLVKTLSRLAKGNRLVLISLHQPRSDIFRLF    211 - 280
DLVLLMTSGTPIYLGAAQHMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFL    281 - 350
EKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLPTLLIH    351 - 420
GAEACLMSMTIGFLYFGHGSIQLSFMDTAALLFMIGALIPFNVILDVISKCYSERAMLYYELEDGLYTTG    421 - 490
PYFFAKILGELPEHCAYIIIYGMPTYWLANLRPGLQPFLLHFLLVWLVVFCCRIMALAAAALLPTFHMAS    491 - 560
FFSNALYNSFYLAGGFMINLSSLWTVPAWISKVSFLRWCFEGLMKIQFSRRTYKMPLGNLTIAVSGDKIL    561 - 630
SVMELDSYPLYAIYLIVIGLSGGFMVLYYVSLRFIKQKPSQDW                               631 - 673
//

Text Mined References (106)

PMID Year Title
27144356 2016 Crystal structure of the human sterol transporter ABCG5/ABCG8.
26088706 2015 ABCG5 and ABCG8 gene polymorphisms in type 2 diabetes mellitus in the Turkish population.
25804128 2015 ABCG8 polymorphisms and renal disease in type 2 diabetic patients.
25056759 2014 Potential effects of NPC1L1 polymorphisms in protecting against clinical disease in a chinese family with sitosterolaemia.
24811295 2014 Recent advances in understanding the STSL locus and ABCG5/ABCG8 biology.
24691589 2014 ABCG5/8 variants are associated with susceptibility to coronary heart disease.
24657701 2014 The ABCG5/8 cholesterol transporter and myocardial infarction versus gallstone disease.
24584735 2014 Inhibition of post-translational N-glycosylation by HRD1 that controls the fate of ABCG5/8 transporter.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24252657 2014 ABCG5/ABCG8 in cholesterol excretion and atherosclerosis.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23840693 2013 Non-cholesterol sterol levels predict hyperglycemia and conversion to type 2 diabetes in Finnish men.
23790976 2013 Cooperative transcriptional activation of ATP-binding cassette sterol transporters ABCG5 and ABCG8 genes by nuclear receptors including Liver-X-Receptor.
23726366 2013 Genome-wide characterization of shared and distinct genetic components that influence blood lipid levels in ethnically diverse human populations.
23707316 2013 High intestinal cholesterol absorption is associated with cardiovascular disease and risk alleles in ABCG8 and ABO: evidence from the LURIC and YFS cohorts and from a meta-analysis.
23406058 2013 Role of the ABCG8 19H risk allele in cholesterol absorption and gallstone disease.
23241408 2013 The ABCG8 G574R variant, serum plant sterol levels, and cardiovascular disease risk in the Old Order Amish.
23179156 2013 ATP-binding cassette sterol transporters are differentially expressed in normal and diseased human gallbladder.
22898925 2013 Genetic and functional identification of the likely causative variant for cholesterol gallstone disease at the ABCG5/8 lithogenic locus.
22869156 2013 Recurrence of gallstones after cholecystectomy is associated with ABCG5/8 genotype.
22655090 2012 ATP-binding cassette transporter G5 and G8 polymorphisms and several environmental factors with serum lipid levels.
22548731 2012 Association of ATP binding cassette transporter G8 rs4148217 SNP and serum lipid levels in Mulao and Han nationalities.
22378727 2012 Serum lipids, plant sterols, and cholesterol kinetic responses to plant sterol supplementation in phytosterolemia heterozygotes and control individuals.
21274884 2011 Sterol transporter adenosine triphosphate-binding cassette transporter G8, gallstones, and biliary cancer in 62,000 individuals from the general population.
21062971 2011 Cholesterol metabolism gene polymorphisms and the risk of biliary tract cancers and stones: a population-based case-control study in Shanghai, China.
21039838 2010 Role of ABCG8 D19H (rs11887534) variant in gallstone susceptibility in northern India.
20854103 2010 Frequencies of four ATP-binding cassette transporter G8 polymorphisms in patients with ischemic vascular diseases.
20837016 2010 Loci from a genome-wide analysis of bilirubin levels are associated with gallstone risk and composition.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20594224 2010 Hepatic cholesterol transporter ABCG8 polymorphisms in gallstone disease in an Indian population.
20592455 2010 Effect of genetic variant (rs11887534) in ABCG8 gene in coronary artery disease and response to atorvastatin therapy.
20581104 2010 ABCG5/G8 polymorphisms and markers of cholesterol metabolism: systematic review and meta-analysis.
20529992 2010 Genetic regulation of serum phytosterol levels and risk of coronary artery disease.
20497293 2010 Gallstone disease in Swedish twins: risk is associated with ABCG8 D19H genotype.
20413122 2010 Soluble fibre (Plantago ovata husk) reduces plasma low-density lipoprotein (LDL) cholesterol, triglycerides, insulin, oxidised LDL and systolic blood pressure in hypercholesterolaemic patients: A randomised trial.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20370913 2010 Genome-wide association analysis of total cholesterol and high-density lipoprotein cholesterol levels using the Framingham heart study data.
20235787 2010 Common sequence variants in pharmacodynamic and pharmacokinetic pathway-related genes conferring LDL cholesterol response to statins.
20210363 2010 Bile acids stimulate ATP hydrolysis in the purified cholesterol transporter ABCG5/G8.
20172523 2010 Genetic variations at ABCG5/G8 genes modulate plasma lipids concentrations in patients with familial hypercholesterolemia.
20170916 2010 Association of selected ABC gene family single nucleotide polymorphisms with postprandial lipoproteins: results from the population-based Hortega study.
20163776 2010 Role of common canalicular transporter gene variations in aetiology of idiopathic gallstones in childhood.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19692220 2010 The effects of ABCG5/G8 polymorphisms on HDL-cholesterol concentrations depend on ABCA1 genetic variants in the Boston Puerto Rican Health Study.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19306529 2009 The ABCG5 ABCG8 sterol transporter and phytosterols: implications for cardiometabolic disease.
19270375 2009 Molecular mechanisms of subcellular localization of ABCG5 and ABCG8.
19217458 2009 The metabolism of plant sterols is disturbed in postmenopausal women with coronary artery disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19111681 2009 Identification of a novel mutation for phytosterolemia. Genetic analyses of 2 cases.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19019257 2009 Long-term consumption of plant stanol and sterol esters, vascular function and genetic regulation.
19018975 2009 Single nucleotide polymorphism in the ABCG8 transporter gene is associated with gallbladder cancer susceptibility.
19012522 2008 Single nucleotide polymorphisms in ABCG5 and ABCG8 genes in Chilean subjects with polygenic hypercholesterolemia and controls.
19005228 2009 The effects of ABCG5/G8 polymorphisms on plasma HDL cholesterol concentrations depend on smoking habit in the Boston Puerto Rican Health Study.
18977479 2009 ABCG8 gene polymorphisms, plasma cholesterol concentrations, and risk of cardiovascular disease in familial hypercholesterolemia.
18850127 2008 Genetic variation in ABC G5/G8 and NPC1L1 impact cholesterol response to plant sterols in hypercholesterolemic men.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18641716 2008 Association between non-responsiveness to plant sterol intervention and polymorphisms in cholesterol metabolism genes: a case-control study.
18581044 2008 Significant association of ABCG8:D19H gene polymorphism with hypercholesterolemia and insulin resistance.
18522623 2008 Polymorphisms in ABCG5/G8 transporters linked to hypercholesterolemia and gallstone disease.
18457353 2008 Significant association of ABCG5 604Q and ABCG8 D19H polymorphisms with gallstone disease.
18007013 2008 Increased expression of LXR alpha, ABCG5, ABCG8, and SR-BI in the liver from normolipidemic, nonobese Chinese gallstone patients.
17827468 2007 Single nucleotide polymorphisms in ABCG5 and ABCG8 are associated with changes in cholesterol metabolism during weight loss.
17690481 2007 Cholesterol and plant sterol efflux from cultured intestinal epithelial cells is mediated by ATP-binding cassette transporters.
17632509 2007 A genome-wide association scan identifies the hepatic cholesterol transporter ABCG8 as a susceptibility factor for human gallstone disease.
17626266 2007 Increased gallstone risk in humans conferred by common variant of hepatic ATP-binding cassette transporter for cholesterol.
17612515 2007 ATP binding cassette G8 T400K polymorphism may affect the risk of gallstone disease among Chinese males.
17403900 2007 Cooperative interaction between hepatocyte nuclear factor 4 alpha and GATA transcription factors regulates ATP-binding cassette sterol transporters ABCG5 and ABCG8.
17102949 2007 Sitosterol and cholesterol in chylomicrons of type 2 diabetic and non-diabetic subjects: the relationship with ATP binding cassette proteins G5 and G8 and Niemann-Pick C1-like 1 mRNA.
17098593 2006 Are plasma lipid levels related to ABCG5/ABCG8 polymorphisms? A preliminary study in siblings with gallstones.
17055487 2006 Co-expression of human ABCG5 and ABCG8 in insect cells generates an androstan stimulated membrane ATPase activity.
16980816 2006 Cholesterol and saturated fat intake determine the effect of polymorphisms at ABCG5/ABCG8 genes on lipid levels in children.
16893193 2006 Purification and ATP hydrolysis of the putative cholesterol transporters ABCG5 and ABCG8.
16870176 2006 Expression and functional characterization of ABCG1 splice variant ABCG1(666).
16518588 2006 Messenger RNA levels of genes involved in dysregulation of postprandial lipoproteins in type 2 diabetes: the role of Niemann-Pick C1-like 1, ATP-binding cassette, transporters G5 and G8, and of microsomal triglyceride transfer protein.
16472606 2006 Liver transplantation in a patient with sitosterolemia and cirrhosis.
15930516 2005 ABCG5 and ABCG8 require MDR2 for secretion of cholesterol into bile.
15816807 2005 ATP-binding cassette transporter G8 M429V polymorphism as a novel genetic marker of higher cholesterol absorption in hypercholesterolaemic Japanese subjects.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15611112 2005 Expression of ABCG5 and ABCG8 is required for regulation of biliary cholesterol secretion.
15520451 2005 Common sequence variations in ABCG8 are related to plant sterol metabolism in healthy volunteers.
15331430 2004 ATP-binding cassette transporter G8 gene as a determinant of apolipoprotein B-100 kinetics in overweight men.
15311998 2004 Polymorphisms in ABCG5 and ABCG8 transporters and plasma cholesterol levels.
15262185 2004 Interactions between common genetic polymorphisms in ABCG5/G8 and CYP7A1 on LDL cholesterol-lowering response to atorvastatin.
15175352 2004 Polymorphisms in the ABCG5 and ABCG8 genes associate with cholesterol absorption and insulin sensitivity.
14703505 2004 ATP binding cassette transporter G5 and G8 genotypes and plasma lipoprotein levels before and after treatment with atorvastatin.
14504269 2003 ABCG5 and ABCG8 are obligate heterodimers for protein trafficking and biliary cholesterol excretion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220438 2002 ATP binding cassette G5 C1950G polymorphism may affect blood cholesterol concentrations in humans.
12208868 2002 Overexpression of ABCG5 and ABCG8 promotes biliary cholesterol secretion and reduces fractional absorption of dietary cholesterol.
12208867 2002 Coexpression of ATP-binding cassette proteins ABCG5 and ABCG8 permits their transport to the apical surface.
12150943 2002 Comparative genome analysis of potential regulatory elements in the ABCG5-ABCG8 gene cluster.
12124998 2002 Mutations in the human ATP-binding cassette transporters ABCG5 and ABCG8 in sitosterolemia.
12111378 2002 Catalog of 605 single-nucleotide polymorphisms (SNPs) among 13 genes encoding human ATP-binding cassette transporters: ABCA4, ABCA7, ABCA8, ABCD1, ABCD3, ABCD4, ABCE1, ABCF1, ABCG1, ABCG2, ABCG4, ABCG5, and ABCG8.
11668628 2001 Mutations in ATP-cassette binding proteins G5 (ABCG5) and G8 (ABCG8) causing sitosterolemia.
11590207 2001 Role of ABCG1 and other ABCG family members in lipid metabolism.
11452359 2001 Two genes that map to the STSL locus cause sitosterolemia: genomic structure and spectrum of mutations involving sterolin-1 and sterolin-2, encoded by ABCG5 and ABCG8, respectively.
11099417 2000 Accumulation of dietary cholesterol in sitosterolemia caused by mutations in adjacent ABC transporters.