Property Summary

NCBI Gene PubMed Count 23
PubMed Score 112.25
PubTator Score 23.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 4.700 1.8e-255
posterior fossa group A ependymoma -1.600 5.0e-15
glioblastoma -1.500 3.3e-12
sonic hedgehog group medulloblastoma -1.600 1.6e-06
atypical teratoid/rhabdoid tumor -1.500 1.7e-09
pediatric high grade glioma -1.600 3.7e-08
pilocytic astrocytoma -1.200 7.5e-07

Gene RIF (15)

PMID Text
26296893 HUWE1 and NEDD4-1 are two E3 ligases that are fundamental enzymes in the post-translational regulation of ABCG1 and ABCG4 protein levels and cellular cholesterol export activity
26270652 Study suggests that high ABCG4 expression is associated with poor prognosis in patients with non-small-cell lung cancer with advanced stages.
25302608 These results suggest that ABCA1, ABCG1, and ABCG4 are localized to distinct membrane meso-domains and disturb the meso-domain structures by reorganizing lipids on the plasma membrane
22391220 This study demonstreated that Abcg4 acts in concert with Abcg2 to efflux Abeta from the brain across the blood-brain barrier.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
18668433 Human ABC transporters ABCG2 (BCRP) and ABCG4
18660489 Observational study of gene-disease association. (HuGE Navigator)
18508037 ABCG4 is highly expressed in microglia on alzheimer disease brain.
16902247 ABCG1 and ABCG4 act in concert with ABCA1 to maximize the removal of excess cholesterol from cells and to generate cholesterol-rich lipoprotein particles
12183068 ABCG4 is expressed specifically in the brain and the eye.
11856881 Human and mouse orthologs of a new ATP-binding cassette gene, ABCG4: maps to human chromosome 11, is expressed abundantly in brain, and has alternatively-spliced isoforms
11606068 ABCG4 may be involved in macrophage lipid homeostasis.

AA Sequence

MAEKALEAVGCGLGPGAVAMAVTLEDGAEPPVLTTHLKKVENHITEAQRFSHLPKRSAVDIEFVELSYSV      1 - 70
REGPCWRKRGYKTLLKCLSGKFCRRELIGIMGPSGAGKSTFMNILAGYRESGMKGQILVNGRPRELRTFR     71 - 140
KMSCYIMQDDMLLPHLTVLEAMMVSANLKLSEKQEVKKELVTEILTALGLMSCSHTRTALLSGGQRKRLA    141 - 210
IALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKSLAQGGRTIICTIHQPSAKLFEMFDKLYILSQGQCI    211 - 280
FKGVVTNLIPYLKGLGLHCPTYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCAMAEKKSSPEKNEVPAP    281 - 350
CPPCPPEVDPIESHTFATSTLTQFCILFKRTFLSILRDTVLTHLRFMSHVVIGVLIGLLYLHIGDDASKV    351 - 420
FNNTGCLFFSMLFLMFAALMPTVLTFPLEMAVFMREHLNYWYSLKAYYLAKTMADVPFQVVCPVVYCSIV    421 - 490
YWMTGQPAETSRFLLFSALATATALVAQSLGLLIGAASNSLQVATFVGPVTAIPVLLFSGFFVSFKTIPT    491 - 560
YLQWSSYLSYVRYGFEGVILTIYGMERGDLTCLEERCPFREPQSILRALDVEDAKLYMDFLVLGIFFLAL    561 - 630
RLLAYLVLRYRVKSER                                                          631 - 646
//

Text Mined References (24)

PMID Year Title
26296893 2015 The E3 ubiquitin ligases, HUWE1 and NEDD4-1, are involved in the post-translational regulation of the ABCG1 and ABCG4 lipid transporters.
26270652 2015 High ABCG4 Expression Is Associated with Poor Prognosis in Non-Small-Cell Lung Cancer Patients Treated with Cisplatin-Based Chemotherapy.
25302608 2014 ABCA1, ABCG1, and ABCG4 are distributed to distinct membrane meso-domains and disturb detergent-resistant domains on the plasma membrane.
22391220 2012 ABCG2- and ABCG4-mediated efflux of amyloid-? peptide 1-40 at the mouse blood-brain barrier.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18668433 2008 Human ABC transporters ABCG2 (BCRP) and ABCG4.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18508037 2008 ATP-binding cassette transporter G4 is highly expressed in microglia in Alzheimer's brain.
16902247 2006 ABCA1 and ABCG1 or ABCG4 act sequentially to remove cellular cholesterol and generate cholesterol-rich HDL.
16870176 2006 Expression and functional characterization of ABCG1 splice variant ABCG1(666).
16682745 2006 Isolation and characterization of human apolipoprotein M-containing lipoproteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15240127 2004 Functional expression and characterization of the human ABCG1 and ABCG4 proteins: indications for heterodimerization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12183068 2002 ABCG4: a novel human white family ABC-transporter expressed in the brain and eye.
12137944 2002 Molecular and cytogenetic characterization of the mouse ATP-binding cassette transporter Abcg4.
11856881 2001 Human and mouse orthologs of a new ATP-binding cassette gene, ABCG4.
11606068 2001 The human ABCG4 gene is regulated by oxysterols and retinoids in monocyte-derived macrophages.
11435397 2001 The human ATP-binding cassette (ABC) transporter superfamily.