Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.97
PubTator Score 11.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Disease Progression 125
Disease Target Count P-value
Breast cancer 3098 2.1e-33
osteosarcoma 7933 1.1e-06
psoriasis 6685 3.8e-05
ovarian cancer 8491 9.7e-05
lung cancer 4473 2.0e-04
glioblastoma 5572 2.2e-04
medulloblastoma, large-cell 6234 1.6e-03
astrocytoma 1493 2.5e-02
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0
Disease Target Count Z-score Confidence
Intestinal tuberculosis 5 3.514 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 2.700 3.8e-05
osteosarcoma -2.038 1.1e-06
astrocytoma 1.100 2.5e-02
glioblastoma 1.100 2.2e-04
medulloblastoma, large-cell 1.100 1.6e-03
lung cancer 1.800 2.0e-04
Breast cancer -1.600 2.1e-33
ovarian cancer -1.700 9.7e-05

 GO Process (1)

Gene RIF (6)

PMID Text
22252987 Overexpression of ABCF2 suppressed RVD.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19002184 Among cervical cancer cases, 149 (55.8%) expressed ABCF2. The overall survival was longer in ABCF2-negative than ABCF2-positive cases
16996567 Data suggest that ABCF2 protein may be a candidate marker for clear cell adenocarcinomas of the ovary and the uterine corpus and may be important for the pathogenesis of these diseases.
16203778 ABCF2 may have a role in progression of clear cell ovarian adenocarcinomas

AA Sequence

MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAA      1 - 70
RAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPE     71 - 140
HIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASR    141 - 210
ILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVL    211 - 280
VSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSA    281 - 350
KLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGI    351 - 420
DLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEI    421 - 490
KEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAIN    491 - 560
EFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNV           561 - 623
//

Text Mined References (25)

PMID Year Title
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22252987 2012 Involvements of the ABC protein ABCF2 and ?-actinin-4 in regulation of cell volume and anion channels in human epithelial cells.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19002184 2008 Can ABCF2 protein expression predict the prognosis of uterine cancer?
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16996567 2007 Differential expression of ABCF2 protein among different histologic types of epithelial ovarian cancer and in clear cell adenocarcinomas of different organs.
16203778 2005 Identification of overexpression and amplification of ABCF2 in clear cell ovarian adenocarcinomas by cDNA microarray analyses.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11435397 2001 The human ATP-binding cassette (ABC) transporter superfamily.
11124703 2001 Characterization of 16 novel human genes showing high similarity to yeast sequences.
10944468 2000 cDNA cloning by amplification of circularized first strand cDNAs reveals non-IRE-regulated iron-responsive mRNAs.
10922475 2000 M-ABC2, a new human mitochondrial ATP-binding cassette membrane protein.
10581359 1999 An inventory of the human ABC proteins.
8894702 1996 Characterization of the human ABC superfamily: isolation and mapping of 21 new genes using the expressed sequence tags database.