Property Summary

NCBI Gene PubMed Count 39
PubMed Score 151.85
PubTator Score 102.92

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.374 4.7e-04
medulloblastoma, large-cell 1.100 4.6e-04
acute quadriplegic myopathy 1.058 4.3e-06
lung cancer 1.600 3.6e-04
diabetes mellitus -1.300 6.3e-03
ovarian cancer 1.600 1.6e-03

Gene RIF (42)

PMID Text
26617714 miR-299-3p promotes the sensibility of lung cancer to doxorubicin through suppression of ABCE1, at least partly. Therefore, the disordered decreased of miR-299-3p and resulting ABCE1 up-expression may contribute to chemoresistance of lung cancer
26600528 Expression of the ABCE1-silencing gene, transfected by electrotransfer, could inhibit the proliferation, invasion, and migration of thyroid cancer cells.
25815591 ABCE1 is closely associated with cell proliferation, invasion and migration in esophageal cancer and silencing the ABCE1 gene by electroporation can significantly reduce the proliferation, invasion and migration capacity
25749978 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
25744244 Downregulation of ABCE1 via siRNA affects the sensitivity of lung cancer cells against chemotherapeutic agents.
25659154 ABCE1 is able to suppress RNA silencing in Nicotiana benthamiana plants, in mammalian HEK293 cells and in the worm Caenorhabditis elegans.
25337191 ABCE1 is closely connected with the pathogenesis and development of oral cancer, which acts through the cellular pathways of 2-5A/RNase L.
25066606 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
24623418 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
24551278 ABCE1 is closely connected with the pathogenesis and development of esophageal carcinoma, which act through the cellular pathways of 2-5A/RNase L.
23305486 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
23266104 Studies indicate a strong sequence conservation of ABC-type ATPase ABCE1 in eukaryotes and archaea.
23008114 ABCE1 protein regulates a broad range of biological functions including viral infection, tumor cell proliferation, and antiapoptosis. (Review)
23008114 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
22851315 To form HIV-1 capsid assembly intermediates, HIV-1 Gag co-opts a complex found in infected and uninfected cells that contains the cellular ATPase ABCE1 and the RNA helicase DDX6, both of which facilitate HIV-1 capsid assembly.
22851315 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
22267055 Report high expression level of ABCE1 mRNA and protein in human lung adenocarcinoma tissues and metastatic lymph nodes, which was also correlated with clinical stages.
22004035 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
21543480 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
21448132 Pelota/Hbs1 induced dissociation of elongation complexes from ribosomes and release of peptidyl-tRNA, but only in the presence of ABCE1.
20372810 Results suggest that ABCE1 plays an important role in the pathogenesis of human small cell lung cancer cell.
20122402 NTP hydrolysis by ABCE1 is stimulated by posttermination complexes and is required for its ribosomal recycling activity.
19657357 were able to confirm the excess of rare genetic variation among HIV-1-positive African-American individuals (n=53; Tajima's D=-2.34). These results highlight the potential importance of ABCE1's role in infectious diseases such as HIV-1.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19020832 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
18189233 common variation in the putative prostate cancer susceptibility gene, RNASEL, or its inhibitor does not contribute significantly to prostate cancer risk in Tobago Afro-Caribbean population
18189233 Observational study of gene-disease association. (HuGE Navigator)
18006034 The primary role of ABCE-1 in the effect of TULA appears to be the recruitment of TULA to the sites of HIV-1 assembly where TULA interferes with the late steps of the HIV-1 life cycle.
18006034 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
17233757 Pulse chase experiments and immunoelectron microscopy shows that HIV-1 Gag associates transiently with ABCE1 during HIV-1 capsid assembly, including at the plasma membrane where assembly is completed.
17233757 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
17222823 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
16275648 For binding of WT HIV-1 Gag to the cellular ATPase ABCE1, which facilitates HIV-1 capsid assembly, the basic residues in the nucleocapsid domain of Gag are required but the cysteine and histidine residues in the nucleocapsid domain are dispensable.
16275648 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
15809757 ABCE1 and its peptides could be target molecules in specific immunotherapy for HLA-A2(+) colon cancer patients.
15107989 overexpression in a permissive cell line had no significant effect on varicella zoster virus replication
14747530 HIV-1, HIV-2, SIV mac239, and SIVagm Gag proteins form ABCE1-containing assembly intermediates during immature capsid formation, indicating that Gag proteins of these diverse retroviruses bind to ABCE1 despite the limited homology between these Gags.
14747530 HIV-2 Gag associates with human HP68 in a cell-free system and that Gag proteins of HIV-2, simian immunodeficiency virus SIVmac239, and SIVagm associate with endogenous HP68 in primate cells, as is seen for HIV-1.
12600646 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable
11780123 During assembly of an immature HIV-1 capsid, HIV-1 Gag progresses through a pathway of sequential assembly intermediates that contain ABCE1, a cellular ATPase that was found to facilitate capsid formation.
11780123 host protein essential for assembly of immature HIV-1 capsids
11780123 The nucleocapsid (NC) domain of Gag is critical for interaction with endogenous ABCE1 in primate cells; basic residues in NC are critical for the Gag-ABCE1 interaction, while the cysteine and histidine residues in the zinc fingers are dispensable

AA Sequence

MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGAL      1 - 70
SIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDW     71 - 140
QEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLK    141 - 210
ERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLD    211 - 280
YLSDFICCLYGVPSAYGVVTMPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKY    281 - 350
PGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKS    351 - 420
TGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSA    421 - 490
YLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLS    491 - 560
QLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD                                   561 - 599
//

Text Mined References (43)

PMID Year Title
26617714 2015 MicroRNA-299-3p promotes the sensibility of lung cancer to doxorubicin through directly targeting ABCE1.
26600528 2015 Effect of ABCE1-silencing gene, transfected by electrotransfer, on the proliferation, invasion, and migration of human thyroid carcinoma SW579 cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25944354 2015 Host interactions of Chandipura virus matrix protein.
25815591 2015 Effects of silencing the ATP-binding cassette protein E1 gene by electroporation on the proliferation and migration of EC109 human esophageal cancer cells.
25744244 2015 Downregulation of ABCE1 via siRNA affects the sensitivity of A549 cells against chemotherapeutic agents.
25659154 2015 ABCE1 is a highly conserved RNA silencing suppressor.
25337191 2014 Knock-down of ABCE1 gene induces G1/S arrest in human oral cancer cells.
24551278 2014 Depleting ABCE1 expression induces apoptosis and inhibits the ability of proliferation and migration of human esophageal carcinoma cells.
23266104 2013 Tying up loose ends: ribosome recycling in eukaryotes and archaea.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23008114 2012 The biological regulation of ABCE1.
22851315 2012 HIV-1 Gag co-opts a cellular complex containing DDX6, a helicase that facilitates capsid assembly.
22267055 2012 Role of the ABCE1 gene in human lung adenocarcinoma.
21448132 2011 Dissociation by Pelota, Hbs1 and ABCE1 of mammalian vacant 80S ribosomes and stalled elongation complexes.
21269460 2011 Initial characterization of the human central proteome.
20372810 2010 A small interfering ABCE1-targeting RNA inhibits the proliferation and invasiveness of small cell lung cancer.
20122402 2010 The role of ABCE1 in eukaryotic posttermination ribosomal recycling.
19946888 2010 Defining the membrane proteome of NK cells.
19657357 2009 An excess of rare genetic variation in ABCE1 among Yorubans and African-American individuals with HIV-1.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18189233 2008 RNASEL and RNASEL-inhibitor variation and prostate cancer risk in Afro-Caribbeans.
18006034 2008 TULA proteins bind to ABCE-1, a host factor of HIV-1 assembly, and inhibit HIV-1 biogenesis in a UBA-dependent fashion.
17488105 2007 Detection and validation of non-synonymous coding SNPs from orthogonal analysis of shotgun proteomics data.
17233757 2007 Host ABCE1 is at plasma membrane HIV assembly sites and its dissociation from Gag is linked to subsequent events of virus production.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16275648 2006 Basic residues in the nucleocapsid domain of Gag are required for interaction of HIV-1 gag with ABCE1 (HP68), a cellular protein important for HIV-1 capsid assembly.
15809757 2005 ABCE1, a member of ATP-binding cassette transporter gene, encodes peptides capable of inducing HLA-A2-restricted and tumor-reactive cytotoxic T lymphocytes in colon cancer patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15107989 2005 Varicella-zoster virus does not significantly induce cell defence mechanism mediated by the 2-5A/RNase L pathway during its replication cycle.
14747530 2004 Conservation of a stepwise, energy-sensitive pathway involving HP68 for assembly of primate lentivirus capsids in cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12600646 2003 The role of Vif during HIV-1 infection: interaction with novel host cellular factors.
12578357 2003 Mutational analysis of the complex of human RNase inhibitor and human eosinophil-derived neurotoxin (RNase 2).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780123 2002 Identification of a host protein essential for assembly of immature HIV-1 capsids.
11585831 2001 The 2-5A/RNase L/RNase L inhibitor (RLI) [correction of (RNI)] pathway regulates mitochondrial mRNAs stability in interferon alpha-treated H9 cells.
9877446 1998 The RNase L inhibitor (RLI) is induced by double-stranded RNA.
9847332 1999 RNase L inhibitor is induced during human immunodeficiency virus type 1 infection and down regulates the 2-5A/RNase L pathway in human T cells.
9660177 1998 RNase L inhibitor (RLI) antisense constructions block partially the down regulation of the 2-5A/RNase L pathway in encephalomyocarditis-virus-(EMCV)-infected cells.
8838820 1996 Localization of the ribonuclease L inhibitor gene (RNS4I), a new member of the interferon-regulated 2-5A pathway, to 4q31 by fluorescence in situ hybridization.
8641422 1996 Chromosomal localization and expression pattern of the RNase L inhibitor gene.
7539425 1995 Cloning and characterization of a RNAse L inhibitor. A new component of the interferon-regulated 2-5A pathway.