Property Summary

NCBI Gene PubMed Count 53
PubMed Score 116.97
PubTator Score 103.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (37)

PMID Text
26515061 ABCC5 is a general glutamate conjugate and analog transporter that affects the disposition of endogenous metabolites, toxins, and drugs.
26353179 genetic association study in population in Mexico: Data suggest SNPs in ABCC5 (3933+313T>C) are not associated with adverse reactions to methotrexate; they protect against myelosuppression in pediatric patients with ALL (acute lymphoblastic leukemia).
25964343 To identify substrates of orphan transporter ATP-binding cassette subfamily C member 5 (ABCC5), identified a class of metabolites, N-lactoyl-amino acids, and found that a protease, cytosolic nonspecific dipeptidase 2 (CNDP2), catalyzes their formation.
25829401 We identified several genes (FasL, MSH2, ABCC5, CASP3, and CYP3A4)that showed association with PFS in patients with osteosarcoma. These pharmacogenetic risk factors might be useful to predict treatment outcome
25564970 The present study investigated the time course and dose dependency of the induction of three efflux proteins, P-gp, MRP1 and MRP5, in response to gemcitabine exposure in Capan-2 pancreatic cancer cell line at transcriptional and translational levels.
25117150 ABCC5 transporter is a novel type 2 diabetes susceptibility gene in European and African American populations.
25028266 The blockade of ABC transporter MRP5 could help to improve drug effectiveness, reduce tumour growth and prevent recurrence in glioblastoma multiforme.
25017019 cCMP is a substrate for MRP5
24603532 This locus was associated with an increase in risk of PACG in a separate case-control study of 4,276 primary angle closure glaucoma cases and 18,801 controls (per-allele OR = 1.13 [95% CI: 1.06-1.22], P = 0.00046).
23271324 Further research is needed to clarify whether MRP5 is indicative of malignant pathological features in meningiomas and whether possible therapeutic implications exist
23174366 ABCC5 functions as a mediator of breast cancer skeletal metastasis. ABCC5 expression in breast cancer cells is important for efficient osteoclast-mediated bone resorption.
22843873 PDE5 is highly expressed and increases ( approximately 130%) during growth whereas ABCC5 exhibited low to moderate expression, with a moderate increase ( approximately 40%) during growth
22278731 The present results imply that MRP5 index may hold a prognostic role in patients with glioblastoma multiforme
22272278 Findings show that the gene expression of ATP-dependent efflux transporters MRP1, -3, -4, -5, and p-gp fluctuated during stem cell-derived retinal pigment epithelial cells (hESC-RPE) maturation.
21449672 This gene-wide tagging study revealed no association between ABCC2, ABCC5 and ABCG2 genetic polymorphisms and multidrug resistance in epilepsy
20922799 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20597995 Results support the idea that isolating survivin and MRP5+ CTCs may help in the selection of metastatic colorectal cancer patients resistant to standard 5-FU and L-OHP based chemotherapy, for which alternative regimens may be appropriate.
19956884 MDR1, MRP2, MRP3 and MRP5 levels are decreased by tetramethylpyrazine in human hepatocellular carcinoma cells
19940267 Results identify key membrane transporters OATP2B1, MRP1, MRP4, and MRP5 as modulators of skeletal muscle statin exposure and toxicity.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903828 Sodium influx is not directly coupled to MRP4/5-mediated cyclic nucleotide efflux, is independent of the status of transporter activity, and determines the baseline membrane potential, which in turns modulates MRP4/5-mediated cyclic nucleotide efflux.
19898482 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19077464 MRP3, MRP4, and MRP5 are upregulated in 5-fluorouracil-resistant cells, and MRP5 contributes to 5-FU resistance in pancreatic carcinoma cells.
18690847 Celecoxib upregulates MRP5 in colon cancer and results in lack of synergy with standard chemotherapy.
17803828 analysis of the outward facing state of the human P-glycoprotein (ABCB1), and comparison to a model of the human MRP5 (ABCC5)
17540771 cGMP may be a physiological regulator of hyaluronan export at the level of the export MRP5
17521428 We have isolated three novel ABCC5 splice variants and characterized their role in the regulation of ABCC5 gene expression. One ABCC5 splice variant produces a truncated ABCC5 protein isoform with thus far unknown functional properties in the retina.
16156793 Plant flavonoids were able to reverse drug resistance in human cells transfected with ABCC5
15861033 analysis of linkage disequilibrium at the nucleotide analogue transporter ABCC5 gene locus
15688370 Upregulation of MRP5 expression is associated with pancreatic carcinoma
15631998 MRP5 expression depends on gestational age and varies throughout the differentiation process.
14507663 Localized in cardiac and cardiovascular myocytes as well as endothelial cells with increased expression in ischemic cardiomyopathy. MRP5-mediated cellular export may represent novel, disease-dependent pathway for cGMP removal from cardiac cells.
12695538 the affinity of MRP4 and MRP5 for nucleotide-based substrates is low.
12646196 MRP1 and MRP5 increase with trophoblast maturation, suggesting a particular role for these proteins in the organ functional developmen
12637526 MRP4 and MRP5 are low affinity cyclic nucleotide transporters that may at best function as overflow pumps, decreasing steep increases in cGMP levels under conditions where cGMP synthesis is strongly induced and phosphodiesterase activity is limiting

AA Sequence

MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLR      1 - 70
ILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHE     71 - 140
SSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFMVKHLLEYTQA    141 - 210
TESNLQYSLLLVLGLLLTEIVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINIC    211 - 280
SNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFASRLTAYFRRKCVAA    281 - 350
TDERVQKMNEVLTYIKFIKMYAWVKAFSQSVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSV    351 - 420
HMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKI    421 - 490
EMKNATLAWDSSHSSIQNSPKLTPKMKKDKRASRGKKEKVRQLQRTEHQAVLAEQKGHLLLDSDERPSPE    491 - 560
EEEGKHIHLGHLRLQRTLHSIDLEIQEGKLVGICGSVGSGKTSLISAILGQMTLLEGSIAISGTFAYVAQ    561 - 630
QAWILNATLRDNILFGKEYDEERYNSVLNSCCLRPDLAILPSSDLTEIGERGANLSGGQRQRISLARALY    631 - 700
SDRSIYILDDPLSALDAHVGNHIFNSAIRKHLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEEL    701 - 770
MNLNGDYATIFNNLLLGETPPVEINSKKETSGSQKKSQDKGPKTGSVKKEKAVKPEEGQLVQLEEKGQGS    771 - 840
VPWSVYGVYIQAAGGPLAFLVIMALFMLNVGSTAFSTWWLSYWIKQGSGNTTVTRGNETSVSDSMKDNPH    841 - 910
MQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMD    911 - 980
EVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLVILFSVLHIVSRVLIRELKRLDNITQSPF    981 - 1050
LSHITSSIQGLATIHAYNKGQEFLHRYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLM   1051 - 1120
HGQIPPAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQE   1121 - 1190
GEVTFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISD   1191 - 1260
IGLADLRSKLSIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLESEVMENGDNF   1261 - 1330
SVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVL   1331 - 1400
AQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG                                    1401 - 1437
//

Text Mined References (58)

PMID Year Title
26515061 2015 ATP-binding Cassette Subfamily C Member 5 (ABCC5) Functions as an Efflux Transporter of Glutamate Conjugates and Analogs.
26353179 2015 Association of ABCB1, ABCC5 and xanthine oxidase genetic polymorphisms with methotrexate adverse reactions in Mexican pediatric patients with ALL.
25964343 2015 N-lactoyl-amino acids are ubiquitous metabolites that originate from CNDP2-mediated reverse proteolysis of lactate and amino acids.
25829401 2015 A First Step toward Personalized Medicine in Osteosarcoma: Pharmacogenetics as Predictive Marker of Outcome after Chemotherapy-Based Treatment.
25564970 2015 Time and concentration dependency of P-gp, MRP1 and MRP5 induction in response to gemcitabine uptake in Capan-2 pancreatic cancer cells.
25117150 2014 ABCC5 transporter is a novel type 2 diabetes susceptibility gene in European and African American populations.
25028266 2014 ABC transporters as differentiation markers in glioblastoma cells.
25017019 2014 cCMP is a substrate for MRP5.
24603532 2014 ABCC5, a gene that influences the anterior chamber depth, is associated with primary angle closure glaucoma.
23271324 2013 Immunohistochemical study of MRP5 expression in meningiomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23174366 2012 ABCC5 supports osteoclast formation and promotes breast cancer metastasis to bone.
22843873 2012 Increased gene expression of the ABCC5 transporter without distinct changes in the expression of PDE5 in human cervical cancer cells during growth.
22278731 2012 Prognostic significance of MRP5 immunohistochemical expression in glioblastoma.
22272278 2012 Efflux protein expression in human stem cell-derived retinal pigment epithelial cells.
21449672 2011 Gene-wide tagging study of the association between ABCC2, ABCC5 and ABCG2 genetic polymorphisms and multidrug resistance in epilepsy.
20922799 2011 Association of multi-drug resistance gene polymorphisms with pancreatic cancer outcome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20597995 2010 Molecular markers in circulating tumour cells from metastatic colorectal cancer patients.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19956884 2010 Inhibition of tetramethylpyrazine on P-gp, MRP2, MRP3 and MRP5 in multidrug resistant human hepatocellular carcinoma cells.
19940267 2010 Human skeletal muscle drug transporters determine local exposure and toxicity of statins.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903828 2010 Dependence of multidrug resistance protein-mediated cyclic nucleotide efflux on the background sodium conductance.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19077464 2009 ATP-binding cassette C transporters in human pancreatic carcinoma cell lines. Upregulation in 5-fluorouracil-resistant cells.
18690847 2008 Celecoxib upregulates multidrug resistance proteins in colon cancer: lack of synergy with standard chemotherapy.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17803828 2007 Molecular model of the outward facing state of the human P-glycoprotein (ABCB1), and comparison to a model of the human MRP5 (ABCC5).
17540771 2007 Hyaluronan export by the ABC transporter MRP5 and its modulation by intracellular cGMP.
17521428 2007 Three novel ABCC5 splice variants in human retina and their role as regulators of ABCC5 gene expression.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16156793 2005 Modulatory effects of plant phenols on human multidrug-resistance proteins 1, 4 and 5 (ABCC1, 4 and 5).
15861033 2005 Strong linkage disequilibrium at the nucleotide analogue transporter ABCC5 gene locus.
15688370 2005 Expression and localization of human multidrug resistance protein (ABCC) family members in pancreatic carcinoma.
15631998 2005 Expression, localization, and function of MRP5 (ABCC5), a transporter for cyclic nucleotides, in human placenta and cultured human trophoblasts: effects of gestational age and cellular differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15297306 2004 The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14507663 2003 Expression and localization of the multidrug resistance protein 5 (MRP5/ABCC5), a cellular export pump for cyclic nucleotides, in human heart.
12695538 2003 Characterization of the transport of nucleoside analog drugs by the human multidrug resistance proteins MRP4 and MRP5.
12646196 2003 Effects of maturation on RNA transcription and protein expression of four MRP genes in human placenta and in BeWo cells.
12637526 2003 Characterization of the MRP4- and MRP5-mediated transport of cyclic nucleotides from intact cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388627 2002 Transporter gene expression in lactating and nonlactating human mammary epithelial cells using real-time reverse transcription-polymerase chain reaction.
10893247 2000 The multidrug resistance protein 5 functions as an ATP-dependent export pump for cyclic nucleotides.
10840050 2000 Multidrug-resistance protein 5 is a multispecific organic anion transporter able to transport nucleotide analogs.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10728601 2000 Increased expression of the MRP5 gene is associated with exposure to platinum drugs in lung cancer.
10721709 2000 Detailed structural analysis on both human MRP5 and mouse mrp5 transcripts.
10438534 1999 pABC11 (also known as MOAT-C and MRP5), a member of the ABC family of proteins, has anion transporter activity but does not confer multidrug resistance when overexpressed in human embryonic kidney 293 cells.
10340910 1999 Re: Characterization of MOAT-C and MOAT-D, new members of the MRP/cMOAT subfamily of transporter proteins.
9827529 1998 Characterization of MOAT-C and MOAT-D, new members of the MRP/cMOAT subfamily of transporter proteins.
9325169 1997 cDNA cloning of a short type of multidrug resistance protein homologue, SMRP, from a human lung cancer cell line.
9270026 1997 Analysis of expression of cMOAT (MRP2), MRP3, MRP4, and MRP5, homologues of the multidrug resistance-associated protein gene (MRP1), in human cancer cell lines.
8894702 1996 Characterization of the human ABC superfamily: isolation and mapping of 21 new genes using the expressed sequence tags database.