Property Summary

NCBI Gene PubMed Count 83
PubMed Score 279.83
PubTator Score 446.75

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (5)

Gene RIF (74)

PMID Text
26107220 ABCC3 rs4148416 polymorphism was significantly associated with poor osteosarcoma response.
25985567 ABCC3 promoter methylation does not seem to exhibit any impact on maximum platelet aggregation and clopidogrel response at all
25788542 Data suggest that hepatic expression of MRP3 is up-regulated and canalicular localization of MRP2 is altered in pediatric patients with advanced nonalcoholic steatohepatitis; these alterations may be involved in changes observed in drug metabolism.
25666946 Epidermal growth factor - mediated epithelial-mesenchymal transition induces ABCC3 mRNA in MDA-MB-468 breast cancer cells. The process is calcium dependant.
25349122 A functional Nrf2 response element within the eighth intron of the ABCC3 gene.
25162314 for ABCC3 variants, little evidence, if any, was found for an association of drug response to genetic variants
25155932 Our data suggest that besides bodyweight, OCT1 and ABCC3 genotypes play a significant role in the pharmacokinetics of intravenous morphine and its metabolites in children
25143454 Renal function of MRP3 is related to renal cell proliferation and cyst formation and that restoring MRP3 may be an effective therapeutic approach for polycystic kidney disease.
25088576 Aberrant expression of MRP3 in rectal cancer confers chemo-radioresistance.
24996541 variants of ABCB1 rs128503, ABCC3 rs4148416, and GSTP1 rs1695 are associated with response to chemotherapy and survival of osteosarcoma patients
24272336 our results suggest that fusion protein scFvM58-sTRAIL with specificity for MRP3 is a highly selective therapeutic agent and may provide an alternative therapy for human Glioblastoma multiforme .
24176985 ABCC3 expression may serve as a marker for MDR and predictor for poor clinical outcome of NSCLC.
24083708 ABCC3 rs4148416 TT polymorphism is associated with poor response to chemotherapy in bone tumors.
23747343 Induction of MRP3 expression by 17alpha-ethynylestradiol requires recruitment of estrogen receptor-alpha and activator protein-1.
23692149 The ABCC3 -211C/T polymorphism seems not to be associated with altered antiplatelet effects and clinical outcomes in clopidogrel-treated patients.
23588304 A predictive model combining variants in TPMT, ABCC3, and COMT with clinical variables significantly improved the prediction of hearing-loss development as compared with using clinical risk factors alone
23443122 These results suggest that carboplatin and paclitaxel may induce drug resistance mediated by MDR1 and MRP3, which may be enhanced by the simultaneous use of both drugs.
23176825 Stimulation of ATPase and substrate translocation show positive cooperativity. Maximal stimulation of ATPase activity is substrate independent.
23069916 human cornea models possessed MRP3 and BCRP expression, whereas no functional expression was found in rabbit and porcine corneas.
22767273 Increased MRP3 gene expression correlates with NRF2 mutations in lung squamous cell carcinomas.
22699933 Anti-ABCC3 IgA and IgG were determined using an enzyme-linked immunosorbent assay (ELISA) approach.
22585709 Amplification and overexpression of the ABCC3 gene is associated with primary breast cancer.
22272278 Findings show that the gene expression of ATP-dependent efflux transporters MRP1, -3, -4, -5, and p-gp fluctuated during stem cell-derived retinal pigment epithelial cells (hESC-RPE) maturation.
22105759 up-regulation of hepatic MRP3/ABCC3 expression in human obstructive cholestasis is likely triggered by TNFalpha, mediated by activation of JNK/SAPK and SP1.
22089114 We demonstrate direct involvement between nuclear factor erythroid-2-related factor 2 and the MRP3 promoter, which leads to the up-regulation of the MRP3 gene.
22016816 effect of ABCB1 and ABCC3 polymorphisms on osteosarcoma survival after chemotherapy
21799180 Low ABCC3 expression was associated with reduced event-free survival of neuroblastoma patients.
21780830 investigation of vectorial transport across enterocytes: Data from Caco-2 cell monolayers, models for intestinal absorption, suggest that MRP3 mediates fexofenadine/zwitterion efflux across basolateral membrane.
21606946 MRP3 A-189 T polymorphism was associated with treatment responses in acute lymphoblastic leukemia , likely due to the change in MRP3 efflux.
21512263 study identified genetic polymorphisms of ABCC3 and evaluated their effects on ABCC3 expression and MRP3 function; 61 genetic variants were identified in three ethnic populations; of these variants 17 were novel
20922799 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20563633 Used a spin-labeled ATP analog, SL-ATP, to study nucleotide binding to highly purified human multidrug resistance protein 3, MRP3.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
19956884 MDR1, MRP2, MRP3 and MRP5 levels are decreased by tetramethylpyrazine in human hepatocellular carcinoma cells
19937796 Immunohistochemical evaluation of human gliomas to determine the localization of MRP3 antigen using scFvs M25 and M58 showed a dense cytoplasmic and membranous staining pattern
19913121 Observational study of gene-disease association. (HuGE Navigator)
19480556 Application of multivariate statistical procedures to identify transcription factors that correlate with MRP2, 3, and 4 mRNA in adult human livers.
19345732 MRP3 induction was dependent upon the transcription factor Nrf2
19343046 Observational study of gene-disease association. (HuGE Navigator)
19334674 analysis of positive allosteric cooperativity for ABCC3-mediated substrate translocation
19114588 Vectorial transport of resveratrol metabolites is mediated by multidrug resistance protein 3 (MRP3, ABCC3) located in the basolateral membranes of enterocytes.
19107936 ABCC3 C-211T and ABCG2 C421A as candidate transporter SNPs to be further investigated as possible predictors of the clinical outcome of chemotherapy in lung cancer patients.
19107936 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19077464 MRP3, MRP4, and MRP5 are upregulated in 5-fluorouracil-resistant cells, and MRP5 contributes to 5-FU resistance in pancreatic carcinoma cells.
18799096 the expression of MRP(multiple drug resistance-associated protein)1, MRP2, and MRP3 molecules in systemic lupus erythematosus mononuclear cells was not different from normal
18698235 Single nucleotide polymorphisms in the ABCC3 gene is associated with acquisition of hepatotoxicity, due to their poor ability to transport toxic compounds
18604784 MRP3 could be a novel molecular marker for localized non-mucinous bronchioloalveolar carcinoma, whose expression increases during the early progression of tumourigenesis
18593940 ABCC3 is a mediator of taxane resistance in HER2-amplified breast cancer.
18313914 No significant association was found between the two ABCC3 polymorphisms and colorectal cancer risk.
18313914 Observational study of gene-disease association. (HuGE Navigator)
18207572 Polymorphisms in ABCC3 is associated with acute myeloid leukemia
18207572 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18038766 induction of ABCC2 and ABCG2 by tBHQ is mediated by the Nrf2/Keap1 system, whereas the induction of ABCC1 may involve a Keap1-dependent but Nrf2-independent mechanism.
17495421 Observational study of genotype prevalence. (HuGE Navigator)
17495421 in this study, the 31 ABCC3 exons and their flanking introns were comprehensively screened for genetic variations in 89 Japanese subjects; forty-six genetic variations, including 21 novel ones, were found
17494643 MRP1-Pro(1150), MRP2-Pro(1158), and MRP3-Pro(1147) in the cytoplasmic loop 7 differ in their influence on substrate specificity but share a common role in the nucleotide interactions at nucleotide binding domain 2 of these transporters.
17485564 Mrp2 and Mrp3 provide alternative routes for the excretion of a glucuronidated substrate from the liver in vivo.
17300812 The ABCC3 -211C>T polymorphism does not affect promotor activity nor FTF transcription factor binding.
17272513 our results indicate that activator Sp1 and repressor RXRalpha:RARalpha act in concert to regulate MRP3 expression. loss of RXRalpha:RARalpha may lead to upregulation of MRP3/Mrp3 expression in cholestatic liver injury.
16946557 The mRNA induction of MDR1, MRP1, MRP2 and MRP3 by rifampicin (Rif), dexamethasone (Dex) and omeprazole (Ome) was investigated in primary cultures of cryopreserved human and rat hepatocytes.
16460798 evidence that clearly indicates that glyburide is preferentially transported by BCRP and MRP3
16424827 a polymorphism -211C>T in the promoter region of MRP3 does not determine the expression level of the gene in acute leukemia
16278398 MRP3, BCRP, and P-glycoprotein have roles in progression of adult acute myeloid leukemia
15824121 VDR has a role in the protection of colon cells from bile acid toxicity through regulation of the Mrp3 expression
15688370 Upregulation of MRP3 expression is associated with pancreatic carcinoma
15167703 Genetic polymorphisms in the MRP3 is associated with liver neoplasms
12704183 MRP3 active transport of estradiol-17-beta-d-glucuronide and MRP3 ATPase characteristics in isolated, inside-out membrane vesicles
12628490 down- and up-regulation of MRP1 (and MRP3) expression can influence cellular folate homeostasis, in particular when cellular retention by polyglutamylation of folates is attenuated.
12220224 possible role in the removal of bile acids from the liver in cholestasis
11850532 tissue distribution and induction in normal human tissues and in cholestasis
11820781 Expression of MRP3 can be induced by certain nonsteroidal anti-inflammatory drugs (e.g., indomethacin) in a reactive oxygen species-dependent but cyclooxygenase-2-independent manner.

AA Sequence

MDALCGSGELGSKFWDSNLSVHTENPDLTPCFQNSLLAWVPCIYLWVALPCYLLYLRHHCRGYIILSHLS      1 - 70
KLKMVLGVLLWCVSWADLFYSFHGLVHGRAPAPVFFVTPLVVGVTMLLATLLIQYERLQGVQSSGVLIIF     71 - 140
WFLCVVCAIVPFRSKILLAKAEGEISDPFRFTTFYIHFALVLSALILACFREKPPFFSAKNVDPNPYPET    141 - 210
SAGFLSRLFFWWFTKMAIYGYRHPLEEKDLWSLKEEDRSQMVVQQLLEAWRKQEKQTARHKASAAPGKNA    211 - 280
SGEDEVLLGARPRPRKPSFLKALLATFGSSFLISACFKLIQDLLSFINPQLLSILIRFISNPMAPSWWGF    281 - 350
LVAGLMFLCSMMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRF    351 - 420
MDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQMKLKDSRIKL    421 - 490
MSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQLLRTAAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPN    491 - 560
NVLDAEKAFVSVSLFNILRLPLNMLPQLISNLTQASVSLKRIQQFLSQEELDPQSVERKTISPGYAITIH    561 - 630
SGTFTWAQDLPPTLHSLDIQVPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWI    631 - 700
QNCTLQENVLFGKALNPKRYQQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDAD    701 - 770
IFLLDDPLSAVDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLADGQVSEMGPYPALLQ    771 - 840
RNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSAL    841 - 910
SSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFWDYAKAVGLCTTLAICLLYVG    911 - 980
QSAAAIGANVWLSAWTNDAMADSRQNNTSLRLGVYAALGILQGFLVMLAAMAMAAGGIQAARVLHQALLH    981 - 1050
NKIRSPQSFFDTTPSGRILNCFSKDIYVVDEVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAV   1051 - 1120
LYTLVQRFYAATSRQLKRLESVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVDANQRSCYPYII   1121 - 1190
SNRWLSIGVEFVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERV   1191 - 1260
KEYSKTETEAPWVVEGSRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKS   1261 - 1330
SMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGSYSEEDIWWALE   1331 - 1400
LSHLHTFVSSQPAGLDFQCSEGGENLSVGQRQLVCLARALLRKSRILVLDEATAAIDLETDNLIQATIRT   1401 - 1470
QFDTCTVLTIAHRLNTIMDYTRVLVLDKGVVAEFDSPANLIAARGIFYGMARDAGLA                1471 - 1527
//

Text Mined References (88)

PMID Year Title
26107220 2015 Quantitative Assessment of the Association between ABC Polymorphisms and Osteosarcoma Response: a Meta-analysis.
25985567 2014 The association of ABCC3 promoter methylation with clopidogrel response in Chinese ischemic stroke patients.
25788542 2015 Altered regulation of hepatic efflux transporters disrupts acetaminophen disposition in pediatric nonalcoholic steatohepatitis.
25666946 2015 A role for calcium in the regulation of ATP-binding cassette, sub-family C, member 3 (ABCC3) gene expression in a model of epidermal growth factor-mediated breast cancer epithelial-mesenchymal transition.
25349122 2015 Identification of a functional antioxidant response element within the eighth intron of the human ABCC3 gene.
25162314 2014 Polymorphisms of the drug transporters ABCB1, ABCG2, ABCC2 and ABCC3 and their impact on drug bioavailability and clinical relevance.
25155932 2014 ABCC3 and OCT1 genotypes influence pharmacokinetics of morphine in children.
25143454 2015 Restoring multidrug resistance-associated protein 3 attenuates cell proliferation in the polycystic kidney.
25088576 2014 Multidrug resistance-associated protein 3 confers resistance to chemoradiotherapy for rectal cancer by regulating reactive oxygen species and caspase-3-dependent apoptotic pathway.
24996541 2014 Predictive potential of ABCB1, ABCC3, and GSTP1 gene polymorphisms on osteosarcoma survival after chemotherapy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24272336 2014 Targeted induction of apoptosis in glioblastoma multiforme cells by an MRP3-specific TRAIL fusion protein in vitro.
24176985 2013 ABCC3 as a marker for multidrug resistance in non-small cell lung cancer.
24083708 2013 Effect of variation of ABCB1 and ABCC3 genotypes on the survival of bone tumor cases after chemotherapy.
23747343 2013 Estrogen receptor-? mediates human multidrug resistance associated protein 3 induction by 17?-ethynylestradiol. Role of activator protein-1.
23692149 2013 Efffect of the ABCC3 -211C/T polymorphism on clopidogrel responsiveness in patients with percutaneous coronary intervention.
23588304 2013 Replication of TPMT and ABCC3 genetic variants highly associated with cisplatin-induced hearing loss in children.
23443122 2012 Modulation of MDR1 and MRP3 gene expression in lung cancer cells after paclitaxel and carboplatin exposure.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23176825 2013 Substrate translocation and stimulated ATP hydrolysis of human ABC transporter MRP3 show positive cooperativity and are half-coupled.
23069916 2013 Expression analysis of MDR1, BCRP and MRP3 transporter proteins in different in vitro and ex vivo cornea models for drug absorption studies.
22767273 2012 MRP3 gene expression correlates with NRF2 mutations in lung squamous cell carcinomas.
22699933 2012 Are circulating autoantibodies to ABCC3 transporter a potential biomarker for lung cancer?
22585709 2012 Amplification and overexpression of the ABCC3 (MRP3) gene in primary breast cancer.
22272278 2012 Efflux protein expression in human stem cell-derived retinal pigment epithelial cells.
22105759 2012 Elevated hepatic multidrug resistance-associated protein 3/ATP-binding cassette subfamily C 3 expression in human obstructive cholestasis is mediated through tumor necrosis factor alpha and c-Jun NH2-terminal kinase/stress-activated protein kinase-signaling pathway.
22089114 2012 Aberrant regulation of the MRP3 gene in non-small cell lung carcinoma.
22016816 2011 Effect of ABCB1 and ABCC3 polymorphisms on osteosarcoma survival after chemotherapy: a pharmacogenetic study.
21799180 2011 ABCC multidrug transporters in childhood neuroblastoma: clinical and biological effects independent of cytotoxic drug efflux.
21780830 2011 Vectorial transport of fexofenadine across Caco-2 cells: involvement of apical uptake and basolateral efflux transporters.
21606946 2012 Polymorphism in multidrug resistance-associated protein gene 3 is associated with outcomes in childhood acute lymphoblastic leukemia.
21512263 2011 Systematic screening of human ABCC3 polymorphisms and their effects on MRP3 expression and function.
20922799 2011 Association of multi-drug resistance gene polymorphisms with pancreatic cancer outcome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20563633 2010 Nucleotide binding to the human multidrug resistance protein 3, MRP3.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
19956884 2010 Inhibition of tetramethylpyrazine on P-gp, MRP2, MRP3 and MRP5 in multidrug resistant human hepatocellular carcinoma cells.
19937796 2010 Recombinant single-chain variable fragment antibodies against extracellular epitopes of human multidrug resistance protein MRP3 for targeting malignant gliomas.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19480556 2009 Application of multivariate statistical procedures to identify transcription factors that correlate with MRP2, 3, and 4 mRNA in adult human livers.
19345732 2009 Multidrug-resistant protein-3 gene regulation by the transcription factor Nrf2 in human bronchial epithelial and non-small-cell lung carcinoma.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19334674 2009 Functional reconstitution of human ABCC3 into proteoliposomes reveals a transport mechanism with positive cooperativity.
19114588 2009 Intestinal breast cancer resistance protein (BCRP)/Bcrp1 and multidrug resistance protein 3 (MRP3)/Mrp3 are involved in the pharmacokinetics of resveratrol.
19107936 2009 Polymorphisms in ABCG2, ABCC3 and CNT1 genes and their possible impact on chemotherapy outcome of lung cancer patients.
19077464 2009 ATP-binding cassette C transporters in human pancreatic carcinoma cell lines. Upregulation in 5-fluorouracil-resistant cells.
18799096 Increased multidrug resistance-associated protein activity in mononuclear cells of patients with systemic lupus erythematosus.
18698235 2008 Functional analysis of nonsynonymous single nucleotide polymorphism type ATP-binding cassette transmembrane transporter subfamily C member 3.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18604784 2008 Expression profile of early lung adenocarcinoma: identification of MRP3 as a molecular marker for early progression.
18593940 2008 Functional genomics identifies ABCC3 as a mediator of taxane resistance in HER2-amplified breast cancer.
18313914 2008 Could polymorphisms in ATP-binding cassette C3/multidrug resistance associated protein 3 (ABCC3/MRP3) modify colorectal cancer risk?
18207572 2008 Polymorphisms in transporter and phase II metabolism genes as potential modifiers of the predisposition to and treatment outcome of de novo acute myeloid leukemia in Israeli ethnic groups.
18038766 2007 Nrf2-dependent and -independent induction of ABC transporters ABCC1, ABCC2, and ABCG2 in HepG2 cells under oxidative stress.
17495421 2007 Genetic variations of the ABC transporter gene ABCC3 in a Japanese population.
17494643 2007 Mutational analysis of a highly conserved proline residue in MRP1, MRP2, and MRP3 reveals a partially conserved function.
17485564 2007 Multidrug resistance proteins 2 and 3 provide alternative routes for hepatic excretion of morphine-glucuronides.
17300812 2007 Functional analysis of the polymorphism -211C>T in the regulatory region of the human ABCC3 gene.
17272513 2007 Nuclear receptors RXRalpha:RARalpha are repressors for human MRP3 expression.
16946557 2006 Regulation of mRNA expression of MDR1, MRP1, MRP2 and MRP3 by prototypical microsomal enzyme inducers in primary cultures of human and rat hepatocytes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16460798 Transport of glyburide by placental ABC transporters: implications in fetal drug exposure.
16424827 2006 In acute leukemia, the polymorphism -211C>T in the promoter region of the multidrug resistance-associated protein 3 (MRP3) does not determine the expression level of the gene.
16278398 2005 MRP3, BCRP, and P-glycoprotein activities are prognostic factors in adult acute myeloid leukemia.
15824121 2005 Vitamin D receptor-dependent regulation of colon multidrug resistance-associated protein 3 gene expression by bile acids.
15688370 2005 Expression and localization of human multidrug resistance protein (ABCC) family members in pancreatic carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15167703 2004 Genetic polymorphisms in the multidrug resistance-associated protein 3 (ABCC3, MRP3) gene and relationship to its mRNA and protein expression in human liver.
14759258 2004 An unappreciated role for RNA surveillance.
12704183 2003 Differential modulation of the human liver conjugate transporters MRP2 and MRP3 by bile acids and organic anions.
12628490 2003 The role of multidrug resistance proteins MRP1, MRP2 and MRP3 in cellular folate homeostasis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220224 2003 Transport of bile acids in multidrug-resistance-protein 3-overexpressing cells co-transfected with the ileal Na+-dependent bile-acid transporter.
11820781 2002 Induction of multidrug resistance proteins MRP1 and MRP3 and gamma-glutamylcysteine synthetase gene expression by nonsteroidal anti-inflammatory drugs in human colon cancer cells.
11745434 2001 Expression of the multidrug resistance proteins MRP2 and MRP3 in human hepatocellular carcinoma.
10772892 2000 Characterization of 5'-flanking region of human MRP3.
10362653 1999 MRP3, a new ATP-binding cassette protein localized to the canalicular domain of the hepatocyte.
10359813 1999 MRP3, an organic anion transporter able to transport anti-cancer drugs.
10340910 1999 Re: Characterization of MOAT-C and MOAT-D, new members of the MRP/cMOAT subfamily of transporter proteins.
10094960 1999 Characterization of the human multidrug resistance protein isoform MRP3 localized to the basolateral hepatocyte membrane.
9889399 1999 Human MRP3 transporter: identification of the 5'-flanking region, genomic organization and alternative splice variants.
9827529 1998 Characterization of MOAT-C and MOAT-D, new members of the MRP/cMOAT subfamily of transporter proteins.
9813153 1998 Isolation of a novel human canalicular multispecific organic anion transporter, cMOAT2/MRP3, and its expression in cisplatin-resistant cancer cells with decreased ATP-dependent drug transport.
9738950 1998 cDNA cloning and inducible expression of human multidrug resistance associated protein 3 (MRP3).
9270026 1997 Analysis of expression of cMOAT (MRP2), MRP3, MRP4, and MRP5, homologues of the multidrug resistance-associated protein gene (MRP1), in human cancer cell lines.
8894702 1996 Characterization of the human ABC superfamily: isolation and mapping of 21 new genes using the expressed sequence tags database.