Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.2e-10
ovarian cancer 8520 6.5e-07
Breast cancer 3578 1.9e-02
active Crohn's disease 922 3.2e-02

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -1.401 3.2e-02
Breast cancer 1.400 1.9e-02
osteosarcoma -4.825 2.2e-10
ovarian cancer -2.700 6.5e-07

Gene RIF (1)

AA Sequence

MLSSTQNAGGSYQRVRGALDTQKCSPEKSASFFSKVTYSWFSRVITLGYKRPLEREDLFELKESDSFCTA      1 - 70
CPIFEKQWRKEVLRNQERQKVKVSCYKEAHIKKPSLLYALWNTFKSILIQVALFKVFADILSFTSPLIMK     71 - 140
QIIIFCEHSSDFGWNGYGYAVALLVVVFLQTLILQQYQRFNMLTSAKVKTAVNGLIYKKALLLSNVSRQK    141 - 210
FSTGEIINLMSATHGLDSKPQSPLVCPFSNPNGRISPLARAGSSSVSRGGSPCVCYTNKCFSCN          211 - 274
//

Text Mined References (12)

PMID Year Title