Property Summary

NCBI Gene PubMed Count 26
PubMed Score 33.75
PubTator Score 38.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.100 8.8e-03
intraductal papillary-mucinous carcinoma... 1.400 1.3e-03
lung cancer 2.600 7.1e-04
Pick disease -1.300 5.2e-06
ovarian cancer 2.400 1.5e-07

Gene RIF (19)

PMID Text
26655271 BAG3-mediated miRNA let-7g and let-7i inhibit proliferation and enhance apoptosis of human esophageal carcinoma cells by targeting the drug transporter ABCC10 and modulates cisplatin resistance.
24937672 ABCC10 expression is correlated with human breast cancer subtype using breast tissue microarrays.
24431074 the combination of paclitaxel and masitinib could serve as a novel and useful therapeutic strategy to reverse paclitaxel resistance mediated by ABCC10
23087055 This report describes the ATPase activity of ABCC10 and further revealed ABCC10 localizes basolaterally using an in vitro system. The described work also identifies the tyrosine kinase sorafenib as an inhibitor of ABCC10.
22739155 Tetrandrine and 5-bromotetrandrine can both reverse multidrug resistance in K562 cells by reducing expression of MRP7.
22082652 Multivariate regression analysis identified carriage of a composite genotype of ABCC10 rs2125739 to be associated with nevirapine plasma concentrations
21628669 Tenofovir is a substrate for ABCC10, and genetic variability within the ABCC10 gene may influence tenofovir renal tubular transport and contribute to the development of kidney tubular dysfunction.
21576088 Study establishes that ABCC10 is able to modulate taxane resistance in vivo using a mouse model.
19841739 Imatinib and nilotinib reverse multidrug resistance in cancer cells by inhibiting the efflux activity of the MRP7 (ABCC10)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19118001 Study establishes that ABCC10 confers resistance to several classes of agents including nucleoside analogs (cytabarine, dideoxycytidine) and epothilone B.
19082471 ABCC10/MRP7 may confer vinorelbine resistance in non-small cell lung cancer
17203221 MDR1 expression, MRP1 expression, and MRP7 expression are refractory factors in head and neck cancer chemotherapy; induction of MRP7 expression is involved in drug resistance to natural products, especially to docetaxel in salivary gland adenocarcinoma
16034073 A non-major histocompatibility complex MRP7 leader peptide ALALVRMLI binds to HLA-E and strongly inhibits natural killer (NK) cell-mediated lysis
15256465 This study shows that ABCC10 confers resistance to the anticancer agents taxanes and vinca alkaloids in vitro.
12566991 The genomic organization and gene expression regulation of human multidrug resistance-associated protein 7 and a splicing variant MRP7A were identified
12527806 First study to describe ABCC10's ability to transport physiological substrates, confirming that this protein, with low identity to ABCC1, was indeed a efflux pump.
12527806 MRP7 has the facility for mediating the transport of conjugates such as E(2)17betaG indicates that it is a lipophilic anion transporter involved in phase III (cellular extrusion) of detoxification.
11146224 First study to describe structure and expression pattern of this transporter.

AA Sequence

MERLLAQLCGSSAAWPLPLWEGDTTGHCFTQLVLSALPHALLAVLSACYLGTPRSPDYILPCSPGWRLRL      1 - 70
AASFLLSVFPLLDLLPVALPPGAGPGPIGLEVLAGCVAAVAWISHSLALWVLAHSPHGHSRGPLALALVA     71 - 140
LLPAPALVLTVLWHCQRGTLLPPLLPGPMARLCLLILQLAALLAYALGWAAPGGPREPWAQEPLLPEDQE    141 - 210
PEVAEDGESWLSRFSYAWLAPLLARGACGELRQPQDICRLPHRLQPTYLARVFQAHWQEGARLWRALYGA    211 - 280
FGRCYLALGLLKLVGTMLGFSGPLLLSLLVGFLEEGQEPLSHGLLYALGLAGGAVLGAVLQNQYGYEVYK    281 - 350
VTLQARGAVLNILYCKALQLGPSRPPTGEALNLLGTDSERLLNFAGSFHEAWGLPLQLAITLYLLYQQVG    351 - 420
VAFVGGLILALLLVPVNKVIATRIMASNQEMLQHKDARVKLVTELLSGIRVIKFCGWEQALGARVEACRA    421 - 490
RELGRLRVIKYLDAACVYLWAALPVVISIVIFITYVLMGHQLTATKVFTALALVRMLILPLNNFPWVING    491 - 560
LLEAKVSLDRIQLFLDLPNHNPQAYYSPDPPAEPSTVLELHGALFSWDPVGTSLETFISHLEVKKGMLVG    561 - 630
IVGKVGCGKSSLLAAIAGELHRLRGHVAVRGLSKGFGLATQEPWIQFATIRDNILFGKTFDAQLYKEVLE    631 - 700
ACALNDDLSILPAGDQTEVGEKGVTLSGGQRARIALARAVYQEKELYLLDDPLAAVDADVANHLLHRCIL    701 - 770
GMLSYTTRLLCTHRTEYLERADAVLLMEAGRLIRAGPPSEILPLVQAVPKAWAENGQESDSATAQSVQNP    771 - 840
EKTKEGLEEEQSTSGRLLQEESKKEGAVALHVYQAYWKAVGQGLALAILFSLLLMQATRNAADWWLSHWI    841 - 910
SQLKAENSSQEAQPSTSPASMGLFSPQLLLFSPGNLYIPVFPLPKAAPNGSSDIRFYLTVYATIAGVNSL    911 - 980
CTLLRAVLFAAGTLQAAATLHRRLLHRVLMAPVTFFNATPTGRILNRFSSDVACADDSLPFILNILLANA    981 - 1050
AGLLGLLAVLGSGLPWLLLLLPPLSIMYYHVQRHYRASSRELRRLGSLTLSPLYSHLADTLAGLSVLRAT   1051 - 1120
GATYRFEEENLRLLELNQRCQFATSATMQWLDIRLQLMGAAVVSAIAGIALVQHQQGLANPGLVGLSLSY   1121 - 1190
ALSLTGLLSGLVSSFTQTEAMLVSVERLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLP   1191 - 1260
NALDGVTFCVQPGEKLGIVGRTGSGKSSLLLVLFRLLEPSSGRVLLDGVDTSQLELAQLRSQLAIIPQEP   1261 - 1330
FLFSGTVRENLDPQGLHKDRALWQALKQCHLSEVITSMGGLDGELGEGGRSLSLGQRQLLCLARALLTDA   1331 - 1400
KILCIDEATASVDQKTDQLLQQTICKRFANKTVLTIAHRLNTILNSDRVLVLQAGRVVELDSPATLRNQP   1401 - 1470
HSLFQQLLQSSQQGVPASLGGP                                                   1471 - 1492
//

Text Mined References (29)

PMID Year Title
26655271 2016 BAG3-mediated miRNA let-7g and let-7i inhibit proliferation and enhance apoptosis of human esophageal carcinoma cells by targeting the drug transporter ABCC10.
24937672 2014 Abcc10 status affects mammary tumour growth, metastasis, and docetaxel treatment response.
24431074 2014 Masitinib antagonizes ATP-binding cassette subfamily C member 10-mediated paclitaxel resistance: a preclinical study.
23087055 2012 Modulation of the ATPase and transport activities of broad-acting multidrug resistance factor ABCC10 (MRP7).
22739155 2012 Mechanisms of tetrandrine and 5-bromotetrandrine in reversing multidrug resistance may relate to down-regulation of multidrug resistance associated protein 7 expression.
22082652 2012 Association of ABCC10 polymorphisms with nevirapine plasma concentrations in the German Competence Network for HIV/AIDS.
21628669 2011 Genetic variants of ABCC10, a novel tenofovir transporter, are associated with kidney tubular dysfunction.
21576088 2011 Contribution of Abcc10 (Mrp7) to in vivo paclitaxel resistance as assessed in Abcc10(-/-) mice.
19841739 2009 Imatinib and nilotinib reverse multidrug resistance in cancer cells by inhibiting the efflux activity of the MRP7 (ABCC10).
19720054 2010 Lapatinib and erlotinib are potent reversal agents for MRP7 (ABCC10)-mediated multidrug resistance.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19150344 2009 Cepharanthine is a potent reversal agent for MRP7(ABCC10)-mediated multidrug resistance.
19118001 2009 Human multidrug resistance protein 7 (ABCC10) is a resistance factor for nucleoside analogues and epothilone B.
19082471 2009 ABCC10/MRP7 is associated with vinorelbine resistance in non-small cell lung cancer.
18974132 2008 The taccalonolides: microtubule stabilizers that circumvent clinically relevant taxane resistance mechanisms.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17897319 2007 Integral and associated lysosomal membrane proteins.
17203221 2007 Multidrug resistance-associated protein 7 expression is involved in cross-resistance to docetaxel in salivary gland adenocarcinoma cell lines.
16034073 2005 Cutting edge: HLA-E binds a peptide derived from the ATP-binding cassette transporter multidrug resistance-associated protein 7 and inhibits NK cell-mediated lysis.
15256465 2004 Analysis of the drug resistance profile of multidrug resistance protein 7 (ABCC10): resistance to docetaxel.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12566991 Genomic structure, gene expression, and promoter analysis of human multidrug resistance-associated protein 7.
12527806 2003 Characterization of the transport properties of human multidrug resistance protein 7 (MRP7, ABCC10).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214971 2000 Characterization of long cDNA clones from human adult spleen.
11146224 2001 Analysis of the structure and expression pattern of MRP7 (ABCC10), a new member of the MRP subfamily.
8894702 1996 Characterization of the human ABC superfamily: isolation and mapping of 21 new genes using the expressed sequence tags database.