Property Summary

NCBI Gene PubMed Count 620
PubMed Score 1383.17
PubTator Score 1223.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Hypercholesterolemia 27
Hyperlipidemia 25
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (34)

Disease log2 FC p
malignant mesothelioma -6.900 2.3e-10
astrocytoma 2.400 3.2e-03
ependymoma 2.500 4.7e-02
oligodendroglioma 1.700 4.6e-02
glioblastoma 2.900 3.4e-04
osteosarcoma 1.872 4.6e-06
atypical teratoid / rhabdoid tumor 2.200 8.1e-06
autosomal dominant Emery-Dreifuss muscul... 1.216 2.6e-03
juvenile dermatomyositis 1.147 5.0e-08
acute quadriplegic myopathy 1.868 1.4e-06
adrenocortical carcinoma -1.955 6.5e-04
tuberculosis -2.900 4.6e-05
pancreatic ductal adenocarcinoma liver m... -2.516 9.9e-04
lung cancer -1.600 9.2e-05
colon cancer -1.600 1.3e-02
active ulcerative colitis -1.879 2.1e-02
sarcoidosis 1.300 1.3e-02
diabetes mellitus -1.200 1.2e-02
cystic fibrosis 1.100 1.2e-03
pediatric high grade glioma 2.300 1.4e-06
group 3 medulloblastoma 1.300 3.5e-02
pilocytic astrocytoma 2.100 3.4e-07
primary Sjogren syndrome 1.200 3.6e-03
subependymal giant cell astrocytoma 3.536 6.4e-03
lung carcinoma -2.100 5.5e-24
Pick disease 1.200 1.4e-02
progressive supranuclear palsy -1.200 3.5e-02
pterygium 1.100 1.3e-02
ductal carcinoma in situ -1.200 5.3e-03
invasive ductal carcinoma -1.400 4.2e-03
ovarian cancer 1.300 1.6e-03
Down syndrome 1.700 3.2e-04
dermatomyositis 1.100 4.2e-04
facioscapulohumeral dystrophy -1.400 4.5e-02

Protein-protein Interaction (7)

Gene RIF (608)

PMID Text
27239842 This review focuses on the role of ABC transporters A1 and G1 in the pathogenesis of atherosclerosis
26891315 The present study shows that there is no significant difference in the genotypic and allelic frequencies of ABCA1 rs2230806, rs3890182 and rs1800976 polymorphisms between a normal weight group and an overweight/obese group.
26828509 ABCA1 gene polymorphisms may be associated with low HDL-C disease; the low HDL-C disease might partly result from interactions between ABCA1 gene polymorphisms and obesity.
26791180 Data suggest that SNPs in ABCA1 alleles and promoter region are associated with variations in (1) DNA methylation, (2) expression of ABCA1, and (3) plasma HDL cholesterol/EPA (eicosapentaenoic acid) levels. [META-ANALYSIS]
26776055 Eicosapentaenoic acid membrane incorporation impairs ABCA1-dependent cholesterol efflux via a protein kinase A signaling pathway in primary human macrophages.
26774504 this study aimed to investigate the relationship between ABCA1 polymorphism and apoA-I and HDL-C in an attempt to elucidate its correlation with abdominal aortic aneurysm occurrence.
26772887 Our study demonstrates that CSE/H2S system is regulated by miR-216a, and regulates ABCA1-mediated cholesterol efflux and cholesterol levels through the PI3K/AKT pathway.
26722555 Our results suggest that ABCA1 polymorphisms influence plasma lipid variability and coronary heart disease risk
26718613 miR-28-5p participates in atherosclerosis via ERK2-mediated upregulation of the ABCA1 pathway.
26681752 Niacin increases HDL particles and total cholesterol efflux capacity but not ABCA1-specific cholesterol efflux in statin-treated subjects.
26617799 Quercetin increased cholesterol efflux from macrophages through upregulating the expressions of PPARgamma and ABCA1.
26608582 The present meta-analysis indicated that the T allelic in rs1883025 variant was significantly associated with the risk of developing AMD, particularly at the early stage.
26592663 Taken together, our study suggests that aging facilitates lesion development in apoE(-/-) mice with greater effect on male mice.
26497474 This work shows that substantial amounts of precursor sterols are transported to a certain PM domain and are removed by the ABCA1-dependent pathway.
26469385 HIV-1 MA increases ABCA1 mRNA expression in HepG2 cells
26451383 R219K polymorphism of ABCA1 gene can be considered as a genetic risk factor for T2DM subjects among Malaysians.
26431478 ABCA1 plays a role in the development of PACG is still not made certain by this study.
26322417 PGG enhances expression of SR-BI and ABCA1 in J774 and THP-1 macrophages
26261553 Lipoxin A4 increases ABCA1 expression and promotes cholesterol efflux through LXRalpha pathway in THP-1 macrophage-derived foam cells.
26243156 The study results suggest that R219K and I883M single nucleotide polymorphisms of the ABCA1 gene may play a role in susceptibility to obesity in the Egyptian population.
26102194 Curcumin enhances cholesterol efflux by upregulating ABCA1 expression through activating AMPK-SIRT1-LXRalpha signaling in THP-1 macrophage-derived foam cells.
26090796 Association between the ABCA1-565C/T gene promoter polymorphism and coronary heart disease severity
26079414 A loss-of-function mutation in ABCA1, present in 1:500 individuals, was associated with low plasma levels of apoE and with high risk of AD and cerebrovascular disease in the general population.
26073400 Myocardial infarction in a 36-year-old man with combined ABCA1 and APOA-1 deficiency.
26051418 Hyperalphalipoproteinemics present a decrease in hsa-miR-33a and higher mRNA expression of ABCA1 and ABCG1.
26045826 analysis showed that the expression levels of ABCA1 mRNA in monocytes were lower than basal line when not intervened with oxidized low density lipoprotein
26004638 Low serum ABCA1 levels were associated with the increases in the concentrations of blood lipid and with the decrease in the concentration of high-density lipoprotein cholesterol
25877294 genetic association studies in a population in Japan: Data suggest that an SNP in ABCA1 (rs2230806, G1051A, R219K) is associated with HDL cholesterol levels in the population studied; the K allele may be protective against coronary artery disease.
25875382 Whole exome sequencing combined with integrated variant annotation prediction successfully identified asymptomatic Tangier disease with novel ABCA1 mutations.
25852127 Lp(a) was internalized by HepG2 cells, however, the ABCA1 response to Lp(a) was mediated by the selective uptake of oxidized phospholipids
25839936 Genetic association studies show that common variants in ABCA1 and SLC16A11 are involved in type 2 diabetes (T2D) susceptibility. Particularly, the variants rs10811661 (CDKN2A/2B) and rs9282541 (ABCA1) are associated with T2D in adult Maya population.
25765596 Diosgenin enhances ABCA1-dependent cholesterol efflux and inhibits aortic atherosclerosis progression by suppressing macrophage miR-19b expression.
25761370 attenuation of ABCA1 protein degradation affects HDL cholesterol efflux capacity.
25744199 Continuous blood purification may be a potent up-regulator of the ABCA1 levels in macrophages of allo-HSCT patients with severe infection.
25734982 4010B-30 increases hepatic ApoA-I gene expression to promote cholesterol efflux via activation of PPARgamma.
25733328 Methyl protodioscin increases ABCA1 expression and cholesterol efflux while inhibiting gene expressions for synthesis of cholesterol and triglycerides by suppressing SREBP transcription and microRNA 33a/b levels.
25704294 findings suggest that circulating miR-28-5p, involved in LXRalpha-ABCA1 pathway, may be a potential biomarker for diagnosis and prognosis of unstable angina.
25665932 The results are consistent with the view that assembly of HDL particles with extracellular apoA-I is primarily with the cellular phospholipid molecules being regulated in part by their physicochemical nature.
25616132 RIP140 negatively regulated the macrophage expression of ATP-binding cassette transporters A1 and G1.
25600616 Propofol up-regulates expression of ABCA1, ABCG1, and SR-B1 through the PPARgamma/LXRalpha pathway in THP-1 macrophage-derived foam cells.
25589556 ABCA1 is the major mediator of human macrophage cholesterol efflux to HDL, demonstrating most marked efficiency with small, dense HDL subfractions (HDL3b and HDL3c).
25579789 L834 in TM6 domain plays an important role in cholesterol and phosphatidylcholine transport by ABCA1.
25527331 ABCA1 C69T polymorphism was associated with an increased atherosclerosis risk. There was no significant association between the ABCA1 V825I polymorphism and atherosclerosis risk. [meta-analysis]
25486791 The level of ABCA1 mRNA and the level of ABCA1 protein in macrophages may be important factors in the development of atherosclerosis.
25445880 ABCA1 mRNA is upregulated in hypercholesterolemic plaques and ABCA1 is expressed in macrophages in human atherosclerotic plaques.
25415591 Akt inhibition promotes ABCA1-mediated cholesterol efflux to ApoA-I through suppressing mTORC1.
25413254 type 2 diabetes mellitus-human serum albumin decreased Abcg1 mRNA expression by 26%
25359426 In Tangier disease, ABCA1 mutations have multiple activities, including plasma membrane remodeling and apoAI binding to cell surface, which participate in nascent HDL biogenesis. (Review)
25339370 MicroRNA-106a confers cisplatin resistance in non-small cell lung cancer A549 cells by targeting adenosine triphosphatase-binding cassette A1.
25302608 These results suggest that ABCA1, ABCG1, and ABCG4 are localized to distinct membrane meso-domains and disturb the meso-domain structures by reorganizing lipids on the plasma membrane
25280398 Pioglitazone increases ABCA1 expression in an LXR-dependent manner and NCEH1 expression in an LXRalpha-independent manner.
25225013 Ang-(1-7) upregulates ABCA1 and ABCG1 expression.
25223800 Our current data indicate that U II may have promoting effects on the progression of atherosclerosis, likely through suppressing ABCA1 expression via activation of the ERK/NF-kappaB pathway.
25198127 ABCA1 in an infected cell localized predominantly to intracellular regions that stain with calnexin-B antibody
25194807 The present study concluded that IL-27 reduces lipid accumulation of foam cell by upregulating ABCA1 expression via JAK2/STAT3.
25181357 The role of cellular cholesterol transport proteins including adenosine triphosphate binding cassette transporter A1 (ABCA1), G1 (ABCG1) and scavenger receptor class B type I (SR-BI) in diabetic nephropathy, was determined.
25173107 Data indicate genome-wide significant association at multiple single nucleotide polymorphism (SNPs) near ATP binding cassette transporter 1 (ABCA1) at 9q31.1 and suggestive evidence of association in phosphomannomutase 2 (PMM2) at 16p13.2.
25173105 Data indicate three loci associated with primary open-angle glaucoma (POAG) were located upstream of ATP binding cassette transporter 1 (ABCA1), within actin filament associated protein 1 (AFAP1) and within GDP-mannose 46-dehydratase (GMDS).
25170080 Nef regulates the activity of calnexin to stimulate its interaction with gp160 at the expense of ABCA1
25170080 HIV-1 MA increases ABCA1 mRNA expression in HepG2 cells
25125487 These data show that loss-of-function mutations in ABCA1 in young adults may be associated with enhanced beta-cell secretory capacity and normal insulin sensitivity and support the role of cholesterol homeostasis in regulating beta-cell insulin secretion.
25121365 The response to antiepileptics seems to be modulated by C3435T in ABCB1 or P-gp activity.
25110219 genetic polymorphism is associated with coronary artery disease in Egyptians
25104170 ABCA1 R219K polymorphism is associated with CHD susceptibility
25084135 MiR-19b directly regulated endogenous ABCA1 expression levels in foam cells derived from human THP-1 macrophages. MiR-19b promotes macrophage cholesterol accumulation, foam cell formation and aortic atherosclerotic development by targeting ABCA1.
25028266 The blockade of ABC transporter ABCA1 could help to improve drug effectiveness, reduce tumour growth and prevent recurrence in glioblastoma multiforme.
25027185 results suggest that ABCA1 R219K polymorphism is associated differently in males and females with elevated log(TG/HDL-C) and decreased LDL-C/HDL-C induced by the high-CHO diet.
25001295 ABCA1 expression and cellular cholesterol efflux in macrophages were significantly decreased in OSAHS patients, which closely correlated with the severity of disease.
24992457 the importance of ABCA1 in the prevention of cardiovascular and metabolic diseases
24970616 Variants in CFH, ABCA1, and ARMS2 genes are related to the presence and progression of drusen in early age-related macular degeneration.
24942079 The present meta-analysis suggests that the ABCA1 rs4149313 polymorphism may contribute to the risk of CHD, especially in Asian populations.
24854628 the ABCA1 R219K variant may have a role in decreased response to pravastatin treatment in heart disease
24842300 Cosyntropin testing in an unselected subgroup of 8 ABCA1 mutation carriers and 3 LCAT mutation carriers did not reveal differences between carriers and controls.
24814410 7-ketocholesteryl-9-carboxynonanoate is a novel PPARgamma agonist, promoting ApoA-I-mediated cholesterol efflux from THP-1 macrophages by increasing ABCA1 expression via induction of PPARgamma.
24813055 These findings suggest that ABCA1 expressed by vascular endothelial cells and alveolar macrophages may play important roles in attenuating the severity of neutrophilic airway inflammation in asthma.
24801727 The present review summarizes the current knowledge and views on the regulatory role of CAV1 on the cholesterol homeostasis with emphasis on the association of CAV1 with ABCA1 and ABCG1. [review]
24796288 This study demonstrated no significant difference in ABCA1 mRNA transcripts and protein levels in the PBMNCs of Acute Myocardial Infarction patients per se or on categorizing them as with/without type 2 diabetes.
24793484 expression of apoA-I or ABCA1 can reduce steatosis by decreasing lipid storage and modifying lipid transport in hepatocytes and may also inhibit fatty acid synthesis by decreasing 27-hydroxycholesterol levels
24751522 PPARgamma negatively regulates the expression of miR-613 at transcriptional level, and miR-613 suppressed LXRalpha and ABCA1 by targeting the 3'-UTR of their mRNAs.
24735204 FGF21 can promote cholesterol efflux by upregulating ABCA1 expression.
24722912 It is inferred that treatment of human neutrophils with oleic acid and an liver X receptor agonist results in a differential effect on the promoter activities of ABCA1 and SREBP1c.
24685762 This study suggests that ABCA1 rs1883025 variants are not associated with nAMD or PCV in a Chinese population, which is likely due to an ethnic difference.
24680682 ABCA1 gene mutation may have "gene-dosage way" effect on in vitro fibroblast senescence. Furthermore, increased ABCG1 and LDLR gene expression could highlight a role of ABCA1 on cytoskeleton regulation associated to cell cholesterol metabolism.
24646941 This study reveals that pharmacological stimulation of the ABCA1-dependent cholesterol efflux pathway disrupts membrane cholesterol homeostasis, leading to the inhibition of virus-cell fusion and thus HCV cell entry.
24636347 High triglyceride levels facilitate ABCA-1 mediated efflux function of HDL in part by activating CETP.
24629160 The role of ABCA1 from macrophages in the efflux of LDL cholestrol is discussed in relation to nitric oxid metabolism in endothelial cells.
24500716 ABCA1 and ABCG1 ubiquitination and degradation are regulated by cellular cholesterol
24493833 Oxidized-LDL significantly induces lincRNA-DYNLRB2-2 expression, which promotes ABCA1-mediated cholesterol efflux and inhibits inflammation through GPR119 in THP-1 cells.
24466114 ATP-binding cassette transporter 1 R219K and M883I polymorphisms are associated with the development of atherosclerosis.
24462860 results suggest that GDF-15 has an overall protective effect on the progression of atherosclerosis, likely through inducing ABCA1 expression via the PI3K/PKCzeta/SP1 signaling pathway and enhancing cholesterol efflux
24406162 Molecular modeling suggests that interaction with HIV-1 Nef may be mediated by a conformational epitope composed of the sequences within the cytoplasmic loop of ABCA1 and the C-terminal cytoplasmic domain.
24406162 HIV-1 MA increases ABCA1 mRNA expression in HepG2 cells
24394674 the more preferentially suppressed ABCA1 expression as compared with CD36 at higher doses of oxLDL stimulation may be the initiator for the formation of macrophage-derived foam cells
24376512 The present study identified a multiplier effect from a polymorphism in CETP with ABCA1, APOA1, and SR-B1, as well as a dose-dependence according to the number of alleles present.
24296892 The frequency of the T allele of the ABCA1 C69T gene was significantly higher in healthy subjects compared to type 2 diabetes mellitus patients.
24157307 This meta-analysis indicates that the ABCA1 gene R219K polymorphism is associated with ischemic stroke in a Chinese population.
24135019 miR-145 regulates ABCA1 expression and function, affecting high-density lipoprotein biogenesis in the liver, and glucose-stimulated insulin secretion in islets.
24113149 The report finds ABCA1 DNA methylation levels on the maternal side of the placenta are correlated with maternal high density HDL-C levels, glucose, cord blood triglyceride and mRNA levels.
24097981 These studies provide the first direct evidence for ABCA1 and ABCA7 functioning as phospholipid transporters and suggest that this activity is an essential step in the loading of apoA-1 with phospholipids for HDL formation.
24081377 New evidence is provided of an effect of ABCA1 variants on Alzheimer's disease risk, highlighting the importance of high throughput sequencing in the identification of rare variation.
23999864 hormonal modulators of glial ABCA1 and apoE
23990020 MiR-128-2 inhibits the expression of ABCA1, ABCG1 and RXRalpha directly through a miR-128-2-binding site within their respective 3'untranslated regions.
23880356 Data suggest that in placentas from women with pre-eclampsia, ABCA1 expression is down-regulated in apical membrane of villous syncytiotrophoblast and in villous fetal endothelial cells; expression of ABCG1 (ABC transporter 8) is unchanged.
23868939 CSL112 elevation of ABCA1-dependent efflux may target atherosclerotic plaque for cholesterol removal.
23739547 Nrf2/HO-1 signaling is required for the regulation by tBHQ of ABCA1 expression and cholesterol efflux in macrophage-derived foam cells and an antiatherogenic role of tBHQ is suggested.
23707398 These data indicate an important role for ABCA1 in intracellular Chlamydia pneumoniae infection.
23705956 ABCA1 mRNA clearance is induced by several microRNAs that result in repression and reduction of ABCA1 protein expression. Intracellular ABCA1 trafficking is enhanced toward the plasma membrane, leading to an elevation of cell-surface localization[review]
23656756 ABCA1 SNP had a statistically significant association with HDL plasma levels.
23620136 Helical domains that mediate lipid solubilization and ABCA1-specific cholesterol efflux in apolipoproteins C-I and A-II
23598720 PPARdelta-ABCA1-Cav1 signaling axis is a novel target of TGF-beta1, which promotes to the oncogenic conversion of TGF-beta1 function in prostate tumorigenesis.
23582768 Inhibition of protein tyrosine phosphatases down-regulates ABCA1 expression, indicating a new level of regulation of a key protein in cholesterol export.
23564066 LXRalpha plays a central role in neopterin-induced downregulation of ABCA1 and ABCG1 in THP-1 macrophage-derived foam cells.
23543682 Data indicate that the larger particles generated in BHK-ABCA1 cells with apoAI at the low available cell lipid:apoAI ratio had no more than 3 apoAI molecules per lipoprotein particle.
23519696 Identify a novel pathway involving FXR, miR-144, and ABCA1 that together regulate plasma HDL-cholesterol.
23479619 the physiological significance of conversion of the ABCA1 monomer to a dimer: The dimer serves as a receptor for two apoA-I molecules for dHDL particle generation.
23402987 Our data suggest that MCP-1 impairs RCT activity in HepG2 cells by a PI3K/Akt-mediated posttranslational regulation of ABCA1, ABCG1, and SR-BI cell-surface expression.
23381994 Authors report here for the first time an association of ABCA1 promoter polymorphisms with susceptibility to severe malaria, especially to cerebral malaria and multiorgan dysfunction.
23305686 ABCA1 and ACAT1 DNA methylation induced by homocysteine may play a potential role in ABCA1 and ACAT1 expression and the accumulation of cholesterol in monocyte-derived foam cells
23275468 Suggest that low LOX-1 expression may lead to insufficient oxLDL uptake, thereby contributing to reduced LXR activation and decreased ABCA1 expression in preeclamptic placentas.
23273975 Patients with type 2 diabetes who have the R230C allele of ABCA1 needed a higher dose of glyburide in order to achieve the same glucose lowering effect as that in persons with the wild type variant.
23233737 cancer-specific ABCA1 hypermethylation and loss of protein expression direct high intracellular cholesterol levels and hence contribute to an environment conducive to tumor progression.
23220274 BIG1, through its ability to activate ADP-ribosylation factor 1, regulates cell-surface levels and function of ABCA1.
23204179 Increased monocyte ABCA1 expression in untreated HIV-infected patients and normalization of ABCA1 expression with virological suppression by ART supports direct HIV-induced impairment of cholesterol efflux.
23181436 this preliminary study showed that the gene variants of ABCA1R219K and LIPC-250 G/A might influence AD susceptibility in South Chinese Han population, but the polymorphism of CETPTaq1B didn't show any association
23179156 The sterol transporters ABCA1, ABCG5, and ABCG8 may play a role in the pathogenesis of human cholesterol related gallbladder diseases.
23152888 This is the first study assessing the effect of the R230C/ABCA1 variant in premature coronary artery disease.
23139370 Genetic variations in ABCA1 and ABCG1 were not associated with increased risk of type 2 diabetes in the general population.
23136402 Results show that Carriers of loss of function ABCA1 mutations display a larger atherosclerotic burden compared with age and sex-matched controls, implying a higher risk for CVD
23132909 a novel function of apoA-IV in the biogenesis of discrete HDL-A-IV particles with the participation of ABCA1 and LCAT
23111454 Common single nucleotide polymorphisms of the ABCA1 gene are not a risk factor for Alzheimer disease. [Meta-analysis]
23109900 Several lipid-related gene polymorphisms interact with overweight/obesity to modulate blood pressure levels.
23103472 ABCA1-dependent CEC, but not serum HDL cholesterol is a significant predictor of PWV in healthy subjects
23053993 The K allele of the ABCA1 R219K gene has a protective role for coronary artery disease risk in Chinese population.
22984509 Apolipoprotein E4 is deficient in inducing macrophage ABCA1 expression and stimulating the Sp1 signaling pathway
22982414 There was no significant association detected between ABCA1 R219K, I883M and R1587K polymorphisms and risk for Alzheimer's disease.[Meta-analysis]
22981231 anticancer activity of ABCA1 efflux function, which is compromised following inhibition of ABCA1 gene expression by oncogenic mutations or cancer-specific ABCA1 loss-of-function mutations.
22959828 Two novel pathogenic mutations in the ABCA1 gene predicted to encode truncated proteins have been linked to Tangier disease and familial HDL deficiency.
22929031 Maternal ABCA1 genotype is associated with severity of Smith-Lemli-Opitz syndrome and with viability of patients homozygous for null mutations.
22913458 ABCA1 represents a novel regulator of lysophosphatidylcholine release during apoptosis
22844345 HIV-1 MA increases ABCA1 mRNA expression in HepG2 cells
22750655 biogenesis and structural constraints involved in forming nascent HDL from ABCA1
22672264 These results strongly suggest that Chlamydia trachomatis co-opts the host cell lipid transport system, including ABCA1 and CLA 1, involved in the formation of HDL to acquire lipids, such as phosphatidylcholine, that are necessary for growth.
22668585 The ABCA1 gene polymorphisms frequency, distribution and lipid profile did not differ according to gender in Greek nurses.
22614118 These data indicate that ABCA1, ABCG1, and SR-BI are reduced in various populations under subclinically inflammatory conditions, which may potentially lead to impairing reverse cholesterol transport and developing atherosclerosis.
22610793 S-Allylcysteine increased ABCA1 mRNA and protein in THP-1 macrophage cells.
22584245 Report role of ABCA1 polymorphisms in determining efficacy of atorvastatin/simvastatin therapy.
22516753 The present study demonstrated that apoM expression could be elevated by ABCA1 via the RXR/LXR pathway and LRH1 does not involve in the regulation of apoM by the activation of ABCA1, although the direct regulative pathway(s) between ABCA1 and apoM gene is still unknown yet.
22503545 PAPP-A may first down-regulate expression of LXRalpha through the IGF-1/PI3-K/Akt signaling pathway and then decrease expression of ABCA1, ABCG1, SR-B1 and cholesterol efflux in THP-1 macrophage-derived foam cells.
22498566 IL-18 and IL-12 together can decrease ABCA1 expression and cellular cholesterol efflux in THP-1 macrophage-derived foam cells through the IL-18R/NF-kappaB signaling pathway.
22466164 Undetectable ABCA1 in insulinomas may reflect a negative feedback in insulin secretion in these patients.
22425645 Gene expression experiments with LDL receptor lacking primary familial hypercholesterolemia (FH) fibroblasts, revealed that SR-BI and ABCA1 are important regulators for cholesterol acquisition in FH cells.
22419126 Epigenetic changes within the ABCA1 gene promoter contribute to the interindividual variability in plasma HDL-C (high-density lipoproteins cholesterol) concentrations and are associated with coronary artery disease expression.
22418575 Studies indicate the direct effects of HDL and its major modulators, ATP-binding cassette transporter A1 (ABCA1), apolipoprotein A-I (ApoA-I), and lecithin cholesterol acyltransferase (LCAT) on the development of type 2 diabetes mellitus (T2D).
22389325 niacin increases apoA-I lipidation by enhancing lipid efflux through a DR4-dependent transcription of ABCA1 gene in HepG2 cells
22384526 ABCA1 C69T polymorphism is not associated with type 2 diabetes mellitus.
22377775 results indicate that the rk genotype or k allele of R219K may relate to the development of AD in the east of China.
22315319 Inhibition of miR-33a expression in apolipoprotein E knockout islets and ABCA1 overexpression in beta-cell-specific ABCA1 knockout islets rescued normal insulin secretion and reduced islet cholesterol
22311493 The genotypes at -14 bp of ABCA1 gene are associated with the plasma level of HDL-C.
22282358 HNF4alpha regulates human hepatic ABCA1 expression in response to cholesterol depletion
22271762 shown that endogenous ApoA-I stabilizes ABCA1, moreover, down-regulation of ApoA-I by siRNA results in an increase of Toll-like receptor 4 (TLR4) mRNA and membrane surface protein expression
22262807 Nef induces degradation of ABCA1 in lysosomes.
22262807 HIV-1 MA increases ABCA1 mRNA expression in HepG2 cells
22248050 lipid-bound apolipoproteins on the surface of spherical HDL particles can behave like lipid-free apoA-I to increase ABCA1 protein levels and activity.
22190032 The effect of the ABCA1-R230C gene variant on HDL-C concentrations is modulated by carbohydrate intake in premenopausal women.
22178419 Impairment of the ABCA1 and SR-BI-mediated cholesterol efflux pathways and HDL anti-inflammatory activity in Alzheimer's disease.
22170052 activation of VLDLR and apoER2 by reelin and apoE induces ABCA1 expression and cholesterol efflux via a Dab1-PI3K-PKCzeta-Sp1 signaling cascade.
22119192 Alterations in Abeta production and clearance are rescued by expression of miR-106b-resistant ABCA1.
22074701 The impact of elaidic acid on the ABCA1 pathway was weaker in cholesterol-normal human monocyte-derived macrophages, but elaidic acid induced a strong reduction of ABCA1-mediated efflux in cholesterol-loaded cells.
22035022 the homocysteine and insulin levels were significantly higher in polycystic ovary syndrome patients with ABCA1 G1051A mutant genotype than those with heterozygote and wild genotypes
22028339 results suggest that ATP hydrolysis at both nucleotide-binding domains induces conformational changes in the extracellular domains, which are associated with apoA-I binding and cholesterol efflux.
21951852 The results suggest that the region of caveolin-1 between amino acids 62 and 100 is an oligomerization domain as well as an attachment site for ABCA1 interaction that regulates HDL-mediated cholesterol efflux.
21920460 ABCA1 behaves both as a lipid exporter and a signaling receptor. [Review]
21885853 MicroRNA-758 regulates cholesterol efflux through posttranscriptional repression of ATP-binding cassette transporter A1.
21875686 mutations in ABCA1, APOA1, and LCAT are sufficient to explain more tha 40 percent of familial hypoalphalipoproteinemia
21860089 ABCA1 may regulate amyloid-beta protein precursor (AbetaPP) processing independent of its impact on membrane lipid homeostasis.
21846716 partitioning of ABCA1/HCBS to nonraft domains plays a pivotal role in the selective desorption of PtdCho molecules by apoA-
21840005 ABCA1 impacts athero-thrombotic risk and has a role in secondary prevention
21839797 Our data suggest a male-specific association of the 1587 K allele of ABCA1 with susceptibility to schizophrenia and smaller gray matter volume in schizophrenia.
21829447 Reduced ATP-binding cassette transporter A1 gene expression is associated with Type 2 diabetes.
21817095 study provided evidence that the ubiquitin-proteasome system is involved in ABCA1/G1 degradation
21763656 modeling and functional testing of an ABCA1 mutation causing Tangier disease
21757691 Lysosomal acid lipase deficiency impairs regulation of ABCA1 gene and formation of high density lipoproteins in cholesteryl ester storage disease
21749932 lysine residues in the extracellular domains of ABCA1 contribute to the interaction with apoA-I
21740892 adiponectin and its receptors increased cholesterol efflux and also enhanced rHDL-induced efflux at least partially through an ABCA1 pathway.
21734188 ApoA-I induces COX-2 expression and PGI-2 release through ABCA1 and the activation of intracellular p38 MAPK, ERK1/2, as well as JAK2 pathways. ApoA-I can reinforce these effects with S1P in HUVECs.
21677398 The result of this study shows that there is no relation between the R219K polymorphism in ABCA1 gene and lipid related variables in the studied population
21643759 ABCA1 R219K polymorphism is a protective factor of coronary heart disease in Asians, but not in Caucasians.
21634116 a significant reduction of ABCA1 mRNA level in leukocytes of patients with atherosclerosis was determined; ABCA1 gene may contribute to the development of atherosclerosis.
21613373 These results confirm associations of age-related macular degeneration with variants near the TIMP3 gene and at loci involved in HDL metabolism
21605865 Thyroid hormone enhances the ability of serum to accept cellular cholesterol via the ABCA1 transporter
21601208 ABCA1 genetic variation may have a role in risk of cardiovascular disease
21591583 Polymorphisms of the ABCA1 and CETP genes are associated with altered plasma HDL-C concentrations.These associations on HDL-C levels are modified by BMI in a Chinese population of the Chengdu area.
21575609 in the case of the p.C978fsX988 truncated mutant a lack of expression precludes it from having a dominant negative effect.
21530801 Unsaturated fatty acids regulate ABCA1 expression in HepG2 and FHs 74 Int cells.
21507939 LXRbeta can cause a post-translational response by binding directly to ABCA1, as well as a transcriptional response, to maintain cholesterol homeostasis.
21501868 ABCA1 shows marked expression levels in diverse placental cell types
21501700 Here, we describe how MPO-dependent chlorination impairs the ability of apolipoprotein A-I (apoA-I), HDL's major protein, to transport cholesterol by the ATP-binding cassette transporter A1 (ABCA1) pathway.
21489276 Findings suggest that the R1587K polymorphism of ABCA1 gene was associated with lipid profile of Greek nurses.
21478209 lack of significant association between mRNA expression of ABCA1 and circulating levels of oxidized LDL/beta2-glycoprotein I complexes
21447678 LIPC and ABCA1 are related to intermediate and large drusen, as well as advanced age related macular degeneration
21389634 ABCA1, an ABC protein, eliminates excess cholesterol in peripheral cells by generating HDL. (Review)
21339300 ATP-binding membrane cassette transporter A1 and signal transducer and activator of transcription 3 have roles in tristetraprolin-dependent post-transcriptional regulation of inflammatory cytokine mRNA expression by apolipoprotein A-I
21315358 The non-synonymous Arg230Cys variant of ABCA1 is associated with low levels of HDL cholesterol levels in Mexican adults.
21310416 The synthesis of available evidence demonstrates that the ABCA1 R219K polymorphism is associated with a higher HDL-cholesterol level in Asians and a protective role for coronary artery disease risk both in Asians and Caucasians.
21300560 K allele of ABCA1 R219K polymorphism is a protective factor associated with decreased CHD susceptibility.
21289254 Effect of bariatric surgery-induced weight loss on SR-BI-, ABCG1-, and ABCA1-mediated cellular cholesterol efflux in obese women.
21247457 The V825I polymorphism in the ABCA1 gene is associated with male serum HDL-C and ApoAI levels in the Han, and serum TC levels in the Bai Ku Yao populations.
21130966 Report associations between common polymorphisms of adenosine triphosphate-binding cassette transporter A1 and coronary artery disease in a Tunisian population.
21117950 the positive changes of ABCA1 gene expression were affected by the ERbeta A1730G polymorphism in women taking estrogen-progesterone therapy.
21111593 Our results indicate that stigmasterol increases ABCA1 and ABCG1 expression.
20972250 Observational study of gene-disease association. (HuGE Navigator)
20951680 These data suggest that PPARgamma may be important for regulation of the level of hepatic ABCA1 protein and indicate the new interplays between PPARgamma, LXRbeta and MEK1/2 in regulation of ABCA1 mRNA and protein expression.
20880529 1 out of 5 patients referred to our hospital because of low HDL cholesterol levels have a functional ABCA1 gene mutation. 16 out of 78 patients (21%) had 19 different ABCA1 gene variants (1 frameshift, 2 splice-site, 4 nonsense and 12 missense)
20855565 Observational study of gene-disease association. (HuGE Navigator)
20835684 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20807164 Hormone replacement therapy in post-menopausal women caused increased leukocyte ABCA1 gene expression.
20800056 Mutations in the genes encoding ABCA1 and apoA-I are common in Norwegians, with a markedly decreased HDL cholesterol level.
20797885 Hyperlipidemic Mexican subjects with the ABCA1 R230C genotype showed lower HDL-concentrations and were better responders to dietary portfolio treatments for increasing HDL-C concentrations than subjects with the R230R genotype.
20797885 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20731376 HIV-1 MA increases ABCA1 mRNA expression in HepG2 cells
20727372 a single session of circuit-resistance exercise increased PBL ABCA1 expression that was more pronounced in 60% and 40% 1-repition maximum groups but not accompanied with significant changes in HDL-C concentrations
20714348 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20702810 An acidic pH reduces foam cell cholesterol efflux via different pathways and particularly impairs the function of the ABCA1 transporter.
20691829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20671065 These results suggest that high-density lipoprotein by an ABCA1-dependent mechanism can mediate signal transduction, leading to increased proliferation and migration of prostate cancer cells.
20643408 PREB regulates the cAMP-mediated transcription of the ABCA1 gene in vascular smooth muscle cells
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625316 D4-F enhances ABCA1 serine phosphorylation and ABCA1-dependent cholesterol efflux through Cdc42/cAMP/PKA pathway in THP-1 macrophage-derived foam cells.
20595220 In untreated familial hypercholesteremia patients, the TT genotype of the ABCA1 C69T polymorphism was associated with increased coronary heart disease risk.
20595220 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20571217 Testing for epistatic interaction between genes in the pathway of cholesterol metabolism NCP1 protein and ABCA1 protein might be useful for predicting Alzheimer's disease risk
20571217 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20553836 These results suggest that the expression level of ABCA1 protein is one of critical determinants of Shiga toxin sensitivity levels in vascular endothelial cells.
20506155 Data suggest that berberine abrogates the formation of foam cells by macrophages by enhancing LXRalpha-ABCA1-dependent cholesterol efflux.
20485864 This review aims to summarize recent findings on the role of inflammatory cytokines, inflammatory proteins, inflammatory lipids, and the endotoxin-mediated inflammatory process in expression of ABCA1.
20479131 HIV-1 MA increases ABCA1 mRNA expression in HepG2 cells
20472936 Results define a new role for macrophage ABCA1 in removing cell-associated LPS and restoring normal macrophage responsiveness.
20430392 Observational study of gene-disease association. (HuGE Navigator)
20427018 data suggest that the R230C ABCA1 gene variant plays an important role in HDL-C level regulation and HDL subclass distribution in healthy Mexican school-aged children
20418488 A functional ABCA1 gene variant is associated with low HD cholesterol and shows positive selection.
20418488 Observational study of gene-disease association. (HuGE Navigator)
20413849 The data of this study indicated that ABCA1 is upregulated in AD hippocampal neurons potentially via an amyloid-beta-mediated pathway.
20395597 Calmodulin binding to ABCA1 protects it from calpain-mediated degradation, and increases the generation of high-density lipoprotein.
20394740 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20385826 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20385819 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378541 apolipoprotein A-I modification by malondialdehyde, but not by an array of other reactive carbonyls, blocks cholesterol efflux by the ABCA1 pathway
20348106 a novel physical and functional interaction between ABCA1 and PDZ-RhoGEF/LARG, which activates RhoA, resulting in ABCA1 stabilization and cholesterol efflux activity.
20346718 There is a synergistic effect between ABCA1 polymorphisms and fenofibrate. Thus, our study indirectly confirms the role of fenofibrate and genotype in increasing cholesterol efflux, as evidenced by increased small HDL particles.
20346718 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20338636 Placental expression of ABCA1 throughout the gestation and its specific cellular localization indicate that this transporter may play an important role in materno-fetal cholesterol transfer.
20303467 The GG genotype in the ABCA1 gene is independently associated with coronary artery disease in Iranian patients.
20303467 Observational study of gene-disease association. (HuGE Navigator)
20227257 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20215580 data suggest large nascent HDL particles, assembled by hepatic ABCA1, generate a PI3 kinase-mediated autocrine signal that attenuates VLDL maturation & TG secretion; this pathway may explain elevated plasma TG concentration in most Tangier subjects
20188211 This review will summarize the results of research on ABCA1, particularly related to Alzheimer's disease and neurodegeneration.
20185793 Healthy young men carrying the minor alleles for i48168 and i27943 of ABCA1 show much higher postprandial lipemia.
20185793 Observational study of gene-disease association. (HuGE Navigator)
20173014 These findings emphasize the mutual cooperation between hormones and cytokines and suggest that increasing estrogen levels with advancing gestation may have a major role in regulating placental MIF secretion.
20170916 the ABCA1 haplotype, which included the rs2230806 A allele, was associated with higher total cholesterol and LDLcholesterol plasma concentrations in men
20170916 Observational study of gene-disease association. (HuGE Navigator)
20167577 Observational study of gene-disease association. (HuGE Navigator)
20160193 Observational study of gene-disease association. (HuGE Navigator)
20103810 TNF-alpha, the major cytokine implicated in the inflammation of Crohn's disease, decreases HDL cholesterol levels by attenuating the expression of intestinal ABCA1 and cholesterol efflux to apoA1.
20101560 These results indicate that the glucose-induced suppression of ABCA1 expression is partially mediated by the activation of the p38-MAPK pathway.
20093111 A variant in intron 8, identified in subjects with low HDL, had no effect on ABCA1 pre-mRNA splicing. Functional analysis is required to establish the effect of intronic mutations on ABCA1 pre-mRNA splicing.
20089670 A2AR occupancy diminishes foam cell formation by stimulating increased reverse cholesterol transport via ABCA1.
20079340 study provides transcriptional and translational evidence that the expression of ABCA1 is dysregulated in the Alzheimer's disease (AD) brain and that this dysregulation is associated with increasing severity of AD
20067955 Carriers of loss-of-function mutations in ABCA1 show impaired insulin secretion without insulin resistance. Our data provide evidence that ABCA1 is important for normal beta-cell function in humans.
20067955 Observational study of gene-disease association. (HuGE Navigator)
20064972 Results show that chlorination of apoA-I by the myeloperoxidase pathway selectively inhibits the binding of apoA-I to ABCA1 and the activation of a key signaling pathway.
20057170 results provide evidence that TGF-beta1 up-regulates expressions of ABCA1, ABCG1 and SR-BI through the LXR alpha pathway in THP-1 macrophage-derived foam cells
20031551 A SNP in ABCA1 is associated with a reduced LDLc lowering effect and to assess the dose response to statin mediated LDLc lowering with respect to specific genotypes.
20031551 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902402 Decreased ABCA1 expression is associated with breast cancer.
19878569 Observational study of gene-disease association. (HuGE Navigator)
19837407 android obesity-related parameters and HDL-PL or prebeta-HDL levels remained the only independent correlates for SR-BI or ABCA1-dependent fractional cholesterol efflux while only prebeta-HDL levels remained correlated to cholesterol extraction capacities.
19828131 HIF-1beta availability determines ABCA1 expression and cholesterol efflux in macrophages under hypoxia and may contribute to the interpersonal variability of atherosclerotic lesion progression.
19783654 ABCA1 functions as an anti-inflammatory receptor
19773416 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19767535 ApoM may function catalytically at an intracellular site to transfer lipid onto pre beta HDL during or after their formation by ABCA1.
19765707 Compound heterozygosity for the nonsense mutation R282X and the missense mutation Y1532C in the ABCA1 gene causes Tangier disease.
19743957 Some rare alleles of ABCA1 are associated with marked phenotypes, supporting the "rare-variant common-disease" hypothesis.
19743957 Observational study of gene-disease association. (HuGE Navigator)
19721717 Observational study of gene-disease association. (HuGE Navigator)
19692220 The effects of ABCG5/G8 polymorphisms on HDL-cholesterol concentrations depend on ABCA1 genetic variants.
19692220 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19673941 TR219K polymorphism of ABCA1 was associated with altered lipoprotein levels and the R219K variant significantly modulated the HDL-C response to pravastatin in Chinese patients with coronary heart disease.
19673941 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19656776 Data show that of IL10, LEP, ABCA1, GNASAS and MEG3 was higher among individuals who were periconceptionally exposed to the famine compared with their unexposed same-sex siblings.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19606474 ABCA1 in dementia, reinforcing the putative involvement of lipid transport in neurodegenerative disease
19606474 Observational study of gene-disease association. (HuGE Navigator)
19596329 The association between ABCA1 variants and risk of ischemic heart disease (Review)
19589783 Cyclosporin A decreases apolipoprotein E secretion from human macrophages via a protein phosphatase 2B-dependent and ATP-binding cassette transporter A1 (ABCA1)-independent pathway.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19556721 ABCA1 may be involved in insulin secretion from pancreatic beta-cells
19556522 Palmitoylation of ATP-binding cassette transporter A1 is essential for its trafficking and function.
19553242 results indicate for the first time in humans that phospholipid and cholesterol efflux are two separate and distinct processes in cellular HDL biosynthesis and the defect in phospholipid efflux is due to defective ABCA1 protein regulation
19538231 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19530967 ABCA1 expression and statins: inhibitory effects reported in peripheral blood mononuclear cells.
19528336 ABCA1 expression is reduced in cultured model intimal and human atherosclerotic lesion smooth muscle cells, suggesting that reduced ABCA1 activity contributes to smooth muscle foam cell formation in the intima
19489872 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19474452 Observational study of genetic testing. (HuGE Navigator)
19446537 Considering synergistic effects between polymorphisms in synthesis and secretion cholesterol-related genes HMGCR and ABCA1 may help in determining the risk profile for disease.
19420105 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19341173 The study did not confirm associations between genetic polymorphisms of ABCA1 transporter, CETP and apoE and abnormal serum lipid profile during remission of nephrotic syndrome.
19341173 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19304576 Rab8 regulates ABCA1 cell surface expression and facilitates cholesterol efflux in primary human macrophages.
19304534 The K allele of R219K polymorphism of ABCA1 is an independent protective factor against atrial fibrillation.
19304534 Observational study of gene-disease association. (HuGE Navigator)
19295162 Transgenic ABCA1 plays a critical role in brain cholesterol homeostasis and regulates behavioral function and synaptic development.
19287193 Western blot experiments demonstrate that ABCA1 and ABCG1 protein levels are synchronously suppressed by high glucose levels and the w6-unsaturated fatty acid linoleic acid.
19285487 Observational study of gene-disease association. (HuGE Navigator)
19268428 These results suggest that COP9 signalosome is a key molecule which controls the ubiquitinylation and deubiquitinylation of ABCA1, and is thus an important target for developing potential drugs to prevent atherosclerosis.
19261092 the inhibitory activity of liver X receptor alpha, ATP-binding cassette transporter and macrophage scavenger receptor A by LPS may be related to the transformation of human macrophages into foam cells.
19258317 ApoA-I-dependent cholesterol efflux mediated by ABCA1 requires formation of two intramolecular disulfide bonds
19202195 the W590S mutation impairs ATP-dependent lipid translocation and that lipid translocation or possibly lipid loading, facilitates apoA-I dissociation from ABCA1
19201688 Tissue-specific roles of ABCA1 influence susceptibility to atherosclerosis.
19201410 PPARg, PPARd and LXRa are involved in the regulation of ABCA1 expression and HDL biogenesis in a cooperative signal transduction pathway
19170766 The retroendocytosis pathway of ABCA1/apoA-I contributes to HDL formation when excess lipoprotein-derived cholesterol has accumulated in cells.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19168441 Human endothelial cells of the placental barrier efficiently deliver cholesterol to the fetal circulation via ABCA1 and ABCG1.
19151332 Data suggest that lipid distribution at the membrane is the primary function of ABCA1, and that it positions the effluxes of cholesterol from cell membranes downstream to the redistribution of the sterol into readily extractable membrane pools.
19148283 Observational study of gene-disease association. (HuGE Navigator)
19133158 although splice mutations in ABCA1 are uncommon, they are worthy of further consideration, particularly in cases where promoter and coding regions of candidate genes fail to identify the genetic basis of very low HDL-C
19131637 study of the influence of ABCA1 and cholesteryl ester transfer protein genetic variants on lipoprotein subclasses demonstrates the importance of interpreting lipoprotein subclasses within the context of the biochemical processes
19131637 Observational study of gene-disease association. (HuGE Navigator)
19099922 Observational study of gene-disease association. (HuGE Navigator)
19070858 Eicosapentaenoic acid reduces ABCA1 serine phosphorylation and impairs ABCA1-dependent cholesterol efflux through cyclic AMP/protein kinase A signaling pathway in THP-1 macrophage-derived foam cells.
19059534 Common genetic variations of ABCA1 had a moderate influence on HDL-C levels and/or coronary heart disease in patients with type 2 diabetes mellitus. These 2 effects were independent.
19059534 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19019193 The homozygotes for mutations which abolish ABCA1 function showed overt signs of involvement of the reticulo-endothelial system.
18996286 Results show no significant association between cardiovascular disease and ABCA1 gene A2589G and G3456C genotypes.
18996286 Observational study of gene-disease association. (HuGE Navigator)
18955690 ABCA1 gene sequence together with a detailed sural nerve biopsy in a family from Afghanistan with a case of progressive syringomyelia-like phenotype and severe premature atherosclerosis.
18927546 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18927311 Single Nucleotide Polymorphism in ABCA1 is associated with susceptibility to radiation dermatitis in breast cancer.
18927311 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18841006 the Y2206D mutation may be associated with not only a lower level of HDL-C, but also with dementia
18841006 Observational study of gene-disease association. (HuGE Navigator)
18820007 These findings establish a critical role for ABCA1 in reverse cholesterol and phospholipid transport in airway smooth muscle cells and suggest that dysregulation of cholesterol homeostasis in these cells may be important in the pathogenesis of diseases.
18805791 analysis of the specificity of ABCA1-dependent cholesterol efflux by peptides
18803945 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18789440 IFN-gamma down-regulates ABCA1 expression by inhibiting LXRalpha in a JAK/STAT signaling pathway-dependent manner
18782758 nuclear liver X receptor-beta interaction with ABCA1 modulates cholesterol efflux
18782226 Findings suggest that the endocytic ABCA1 has cholesterol efflux activity, and thus the cellular control of post-endocytic sorting, retention or recycling of ABCA1 in the endocytic vesicles is important for cholesterol metabolism in living cells.
18776170 missense mutations in ABCA1 impair lipid export, apoA-I binding, and apoA-I-stimulated JAK2 activities to similar extents, indicating that these processes are highly interactive components of a pathway that functions to export lipids from cells.
18767813 Ability of the lipid transporter ABCA1 and apolipoprotein CIII to promote the de novo biogenesis of apoCIII-containing high density lipoproteins in vivo.
18762171 Stimulation of hydrolysis of cholesteryl ester in macrophages induces the expression of ABCA1 gene primarily via the LXR-dependent pathway and can be useful for the prevention of atherosclerosis.
18711208 ABCA1-mediated cholesterol efflux is independent of cholesterol synthesis
18706283 Various studies have identified debatable and sometimes inconsistent results with respect to the risk on MI attributed by common genetic variation in ABCA1.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18640393 No associations between fasting glucose, hemoglobin A(1c), plasma lipids, or oxLDL and the expression of ABCG1, ABCA1, or SR-BI were found in diabetic patients.
18621447 The K allele of R219K polymorphism is an independent protective factor against ACI. Though there is no association of V825I with ACI, this polymorphism has synergistic effects with hypertension in susceptibility to ACI.
18621447 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18617649 ApoA-I facilitates ABCA1 recycle/accumulation to cell surface by inhibiting its intracellular degradation and increases high density lipoprotein generation.
18583707 Interaction of apolipoprotein A-I (apoA-I) with ATP binding cassette transporter 1 imparts a unique conformation that partially determines the in vivo metabolic fate of apoA-I in transgenic mice.
18566305 Observational study of gene-disease association. (HuGE Navigator)
18523221 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18523221 Lower plasma levels of HDL cholesterol due to heterozygosity for loss-of-function mutations in ABCA1 were not associated with an increased risk of IHD.
18484747 Physical interaction of ABCA1 and SPTLC1 results in reduction of ABCA1 activity and that inhibition of this interaction produces enhanced cholesterol efflux.
18468402 Study results suggest that polymorphisms of ABCA1 C69T may be associated with plasma triacylglycerol and VLDL-cholesterol levels in coronary artery patients.
18468402 Observational study of gene-disease association. (HuGE Navigator)
18385134 ATP-binding cassette transporter (ABC) A1 is required for the lipidation of apolipoprotein A-I to generate high density lipoprotein (HDL).
18354102 Observational study of gene-disease association. (HuGE Navigator)
18343215 ABCA1 Q597R mutant trafficking to the plasma membrane was rapidly induced by thapsigargin or DTT, indicating that ER stress-induced QR trafficking.
18287097 ABCA1-dependent cholesterol efflux requires an amphipathic helical region of the N-terminal barrel of phospholipid transfer protein
18252847 Study of HDL particles formed when lipid-free apoA-I was incubated with fibroblasts in which expression of the ABCA1 was upregulated.
18239666 Observational study of gene-disease association. (HuGE Navigator)
18220685 ABC-A1 may be more than a determinant of HDL-cholesterol which may provide a link between components of the metabolic syndrome and atherosclerosis.
18219093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18218626 apoA-I specifically mediates the continuous endocytic recycling of ABCA1
18215356 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18199144 Observational study of gene-disease association. (HuGE Navigator)
18199144 Mutations were identified in 5 low-HDL subjects. 4 SNPs in ABCA1 gene promoter identified the C-14T SNP & the TCCT haplotype to be over-represented in low-HDL individuals. Sequence variation in ABCA1 contributes significantly to variation in HDL levels.
18164264 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18097620 Observational study of gene-disease association. (HuGE Navigator)
18097620 These results suggest that polymorphisms of ABCA1 and ROS1 are determinants of blood pressure and the development of hypertension in Japanese individuals.
18057374 plasma from men displayed an enhanced free cholesterol efflux capacity via the ABCA1 transporter pathway compared with that from women, which resulted from a 2.4-fold increase in the plasma level of prebeta particles
18003760 Observational study of gene-disease association. (HuGE Navigator)
17992631 The interaction of ABCA1 with AOX1 modulates ABCA1-linked cellular functions such as lipid efflux and phagocytosis in hepatocytes (HC), and reduced expression of AOX1 in malignant transformed HC supports the differentiation dependent upregulation of AOX1.
17991739 Experiments employing an ABCA1 promoter-luciferase reporter confirmed that ORP8 silencing enhances ABCA1 transcription and the silencing effect was partially attenuated by mutation of the DR4 element in the ABCA1 promoter.
17951323 Observational study of gene-disease association. (HuGE Navigator)
17951323 3 of 6 nonsynonymous single nucleotide polymorphisms in ATP-binding cassette sub-family A (ABC1) member 1 (ABCA1) predict risk of ischemic heart disease in the general population.
17923263 Observational study of gene-disease association. (HuGE Navigator)
17923263 R219K polymorphism of ABCA1 related with low HDL in overweight/obese Thai males.
17855807 Observational study of gene-disease association. (HuGE Navigator)
17710129 These results show that mutations in ABCA1 do not measurably reduce the rate of transbilayer movements of phospholipids in either the engulfing macrophage or the apoptotic target.
17700364 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17690481 results indicate that ABCG5/G8, unlike ABCA1, together with bile acids should participate in sterol efflux on the apical surface of Caco-2 cells.
17689273 Results revealed that TNF-alpha could increase cholesterol content by down-regulating ABCA1 expression, IL-10 time-dependently decreased cholesterol accumulation by up-regulating ABCA1 expression.
17656736 Our results provide a biochemical basis for the HDL biogenesis pathway that involves both ABCA1 and the "high-capacity binding site", supporting a two binding site model for ABCA1-mediated nascent HDL genesis.
17608096 Observational study of gene-disease association. (HuGE Navigator)
17556657 Doxazosin inhibits AP2alpha activity independent of alpha(1)-adrenoceptor blockade and increases the ABCA1 expression and HDL biogenesis
17553166 Observational study of gene-disease association. (HuGE Navigator)
17553166 Our study does not support a major role for the ABCA1 gene as a risk factor for ischaemic stroke
17550732 Observational study of gene-disease association. (HuGE Navigator)
17521614 Taken together, the current study demonstrates that APN might protect against atherosclerosis by increasing HDL assembly through enhancing ABCA1 pathway and apoA-1 synthesis in the liver.
17510949 Intronic polymorphism of ABCA1 gene is associated with sporadic Alzheimer's disease
17510946 the relationship between ABCA1 genetic variants and Alzheimer's disease (AD), independently or in concert with the APOE epsilon4 allele
17510466 Interaction of apoA-I with ABCA1 results in the simultaneous generation of pre-beta HDLs of discrete size and chemical composition.
17481640 ABCA1 expression in human leukocytes and muscle is associated with physical activity and alcohol consumption, respectively
17430597 Observational study of gene-disease association. (HuGE Navigator)
17412755 Observational study of gene-disease association. (HuGE Navigator)
17412755 an influence of common ABCA1 functional polymorphisms on age of symptom onset in coronary artery disease patients
17407076 Results suggest that R219K polymorphism in ABCA1 gene is not only associated with serum HDL-C and TG levels in healthy Chinese subjects in Chengdu area, but also with HDL-C level and TC/HDL-C ratio in subjects with endogenous HTG.
17407076 Observational study of gene-disease association. (HuGE Navigator)
17383594 Observational study of gene-disease association. (HuGE Navigator)
17383594 Rare mutations in ABCA1 are associated with low HDL-C. However, at least 1 ABCA1 polymorphism (eg, E1172D) may contribute to the high HDL-C phenotype.
17372331 Observational study of gene-disease association. (HuGE Navigator)
17372331 Results suggest that defective ABCA1 function in cholesterol-loaded macrophages is one potential contributor to the impaired reverse cholesterol transport process and the increased coronary heart disease risk in subjects with familial low HDL.
17368464 Observational study of gene-disease association. (HuGE Navigator)
17368464 analysis of genetic variation in the ATP-binding cassette transporter A1, plasma lipids, and risk of coronary heart disease
17335784 Observational study of gene-disease association. (HuGE Navigator)
17335784 An obvious association between polymorphisms of ABCA1 gene and AD was found; the risk for AD was significantly decreased in K allele (RK+KK genotypes) or KK homozygote carriers compared with RR genotypes carriers.
17324514 Observational study of gene-disease association. (HuGE Navigator)
17287470 This is the first study reporting the association of the ATP-binding cassette transporter A1 R230C variant with obesity and obesity-related comorbidities in the Mexican population.
17268197 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17268197 ABCA1 gene I823M polymorphism altered plasma HDL-C level and also modified the effect of low-HDL-C on the risk of CAD.
17241464 Results show that ABCA1 mRNA expression increased in response to dexamethasone in primary rat hepatocytes however, the effect was absent or inhibitory in human HepG2 cells and THP-1 macrophages due to low glucocorticoid receptor levels.
17205124 in a system of forced expression by transfection, MEGF10 function can be modulated by the ATP binding cassette transporter ABCA1, ortholog to CED-7
17196163 The results suggest the promoting effects of AngII on the forming of foam cells are in a dose-dependent manner via down-regulating the expression of ABCA1.
17135600 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17135302 ROS and NF-kappaB, but not LXR, mediate the IL-1beta-induced downregulation of ABCA1 via a novel transcriptional mechanism, which might play an important role of proinflammation in the alteration of lipid metabolism.
17121837 ABCA1 plays a significant role in the regulation of neuronal cholesterol efflux to apolipoprotein E discs.
17113061 Observational study of gene-disease association. (HuGE Navigator)
17082211 Two genes of the cholesterol efflux system (ABCA1 and ABCG1) were down-regulated in HCAECs exposed to uraemic plasma.
17076584 HIV-1 MA increases ABCA1 mRNA expression in HepG2 cells
17070530 ABCA1 polymorphism is associated with the pathogenesis of coronary heart disease in Germany.
17020879 NPC1 protein function is non-essential for the trafficking and removal of cellular cholesterol by ApoAI if the down-stream defects in ABCA1 and ABCG1 regulation in NPC disease cells are corrected using an LXR agonist
17001213 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16928680 hepatic overexpression of ABCA1 in low density lipoprotein receptor-KO mice leads to: 1) expansion of the pro-atherogenic apoB-lipoprotein cholesterol pool size via enhanced transfer of HDL-cholesterol to apoB-lipoproteins
16902247 ABCG1 and ABCG4 act in concert with ABCA1 to maximize the removal of excess cholesterol from cells and to generate cholesterol-rich lipoprotein particles
16901265 The role of SREBP-2 in the regulation of ABCA1 transcription via generation of oxysterol ligands for liver X receptor is reported.
16879828 Observational study of gene-disease association. (HuGE Navigator)
16873719 generation in vitro of 15 missense mutations that have been described in patients with Tangier disease and familial hypoalphalipoproteinemia. (ABCA1)
16855366 REVIEW: the presence of ABCA1 and ABCG1 in the AP-3 pathway will have major impact for membrane phospholipid processing and HDL metabolism and their relation to disorders of lysosome-related organelles
16825673 ABCA1 is expressed in keratinocytes, where it is negatively regulated by a decrease in cellular cholesterol levels or altered permeability barrier requirements and regulated by activators of LXR, PPARs, and RXR or increases in cellular cholesterol levels
16806540 Observational study of gene-disease association. (HuGE Navigator)
16806540 ABCA1 polymorphisms are associated with varying plasma levels of HDL-C in Pakistani individuals.
16770077 Observational study of gene-disease association. (HuGE Navigator)
16763159 Observational study of gene-disease association. (HuGE Navigator)
16730733 Suppression of both the ABCA1 and ABCG1 genes may indicate that unsaturated fatty acids suppress not only cholesterol efflux to apoA-I and thereby nascent HDL formation but also HDL-dependent cholesterol efflux from vascular cells.
16725228 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16725228 This study suggest a gender-specific and APOE and UBQLN1 independent association between the ABCA1/R219K polymorphism and late-onset Alzheimer's disease.
16709568 Fluorescence resonance energy transfer and native plyacrylamide gel electrophoresis analytical techniques were employed to assess the quaternary structure of ABCA1
16596262 Observational study of gene-disease association. (HuGE Navigator)
16596262 data support the observation that ABCA1 polymorphisms influence cholesterol metabolism of the brain, but might not act as a major risk factor in Alzheimer's disease.
16542392 Observational study of gene-disease association. (HuGE Navigator)
16505586 ABCA1 is a rate-limiting factor of HDL assembly and is regulated by transcriptional and post-transcriptional factors. Post-transcriptional regulation of ABCA1 involves modulation of its calpain-mediated degradation.
16500904 analysis of the biochemical basis of the mechanism for HDL formation mediated by ABCA1
16497665 oxidation by myeloperoxidase impairs the ability of apoA-I to promote cholesterol efflux by the ABCA1 pathway, suggesting that this oxidative process might contribute to foam cell formation and atherogenesis
16456089 ABCA1 upregulation in macrophages inhibits the progression of atherosclerotic lesions
16446539 Observational study of gene-disease association. (HuGE Navigator)
16443932 Results suggest that ABCA1 transduces signals from apolipoprotein A-I (apoA-I) by complexing and activating Cdc42 and downstream kinases and, therefore, acts as a full apoA-I receptor.
16429166 Impact of genetic variation on ABCA1 function.
16418537 Results show that the products of the apoA-I/ABCA1 interaction include discoidal HDL particles containing different numbers of apoA-I molecules.
16410457 ABCA1-mediated efflux to serum responds to the pool of lipid-free/poor apolipoproteins
16343503 Approximately 20% of French-Canadian patients with severe HDL deficiency are associated with a defective ABCA1.
16313984 Observational study of gene-disease association. (HuGE Navigator)
16313984 ABCA! polymorphisms and prognosis after myocardial infarction were analyzed in a young male cohort.
16254209 Glucocorticoid receptor ligands affected ABCA1 expression and cholesterol efflux from macrophages
16235041 A review of functions and mutations of ABCA1 in Tangier disease.
16226177 Observational study of gene-disease association. (HuGE Navigator)
16207713 ABCA1 plays a role in the pathogenesis of parenchymal and cerebrovascular amyloid pathology
16192269 beta1-syntrophin acts through a class-I PDZ interaction with the C terminus of ABCA1 to regulate the cellular distribution and activity of the transporter
16166555 mABC1 protein plays a major role in cellular protection against oxidant stress.
16157450 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16157450 Based on the results of genome-wide screens, along with biological studies, we selected three genes as candidates for AD risk factors: ATP-binding cassette transporter A1 (ABCA1), cholesterol 25-hydroxylase (CH25H) and cholesterol 24-hydroxylase (CH24H).
16126721 the ABCA1 pathway is impaired by acrolein-induced apoA-I modification
16120575 Observational study of gene-disease association. (HuGE Navigator)
16118212 intracellular unsaturated acyl-CoA derivatives destabilize ABCA1 by activating a PLD2 signaling pathway
16086925 Observational study of gene-disease association. (HuGE Navigator)
16080812 The ABCA1 R219K polymorphism may be involved in the variability of serum HDL-C and the susceptibility to coronary artery disease.
16080812 Observational study of gene-disease association. (HuGE Navigator)
16055210 An amino acid substitution in ABCA1 is associated with low levels of HDL and diabetes mellitus, type 2.
16030523 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16009332 In this report, a relationship between ApoA-I, DM and ABCA1 has been emphasized.
15983222 Glycolaldehyde and glyoxal strongly inhibited ABCA1-dependent transport of cholesterol from cells to apoA-I, while methylglyoxal had little effect.
15961705 dramatic decrease of ABCA1 protein, the key molecule of cholesterol efflux, in atheroma
15958302 Observational study of gene-disease association. (HuGE Navigator)
15952113 Result exhibited an interaction of PON1 gene polymorphism A/B192 and ABCA1 genetic variation R219K on serum lipid level.
15952113 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15951431 the internalization and trafficking of ABCA1 is functionally important in mediating cholesterol efflux from intracellular cholesterol pools
15935359 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15935359 The role of high levels of HDL cholesterol in protection against development of atherosclerosis is generally attributed to its role in reverse cholesterol transport, and the ATP binding cassette transporter A1 is a key element of this process.
15930518 The ABCA1-mediated reaction produced two distinct HDLs, large cholesterol-rich and small cholesterol-poor particles, and the former is more prominently dependent on the increase of ABCA1 expression
15905177 analysis of headgroup-specific exposure of phospholipids in ABCA1-expressing cells
15890646 cholesterol efflux via the ABCA1/apoA-I pathway is enhanced by the GSL synthesis inhibitor PDMP
15851589 Deficiency of macrophage ACAT1 accelerates atherosclerosis in apoE-/- mice but has no effect when hypercholesterolemia is corrected by apoE expression. ACAT1 deletion impairs ABCA1-mediated cholesterol efflux in macrophages regardless of apoE expression
15829498 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15817453 RhoA has a role in ABCA1-mediated cholesterol efflux
15774904 Catalytic subunits of SWI/SNF chromatin remodeling complex, BRG-1 and brahma, play significant roles in enhancing LXR/RXR-mediated transcription of ABCA1 via the promoter DR-4 element
15721294 Observational study of gene-disease association. (HuGE Navigator)
15721294 type 2 diabetes is associated with ABCA1 gene polymorphisms in a Japanese population
15696473 The allelic frequencies of A and G of ABCA1 gene are 53.4% and 46.6% and the genetic polymorphisms of ABCA1 in Chinese Han ethnic population are significantly different from Caucasians residing in USA or Europe.
15696473 Observational study of genotype prevalence. (HuGE Navigator)
15657615 Observational study of gene-disease association. (HuGE Navigator)
15649702 Observational study of gene-disease association. (HuGE Navigator)
15574409 apolipoprotein A-I chlorination markedly impairs ABCA1-dependent cholesterol transport
15528481 Observational study of gene-disease association. (HuGE Navigator)
15528481 The ABCA1 gene -565C>T polymorphism was associated with coronary atherosclerosis severity. This variant had an effect on ABCA1 promoter activity. Common ABCA1 variants contribute to interindividual variability in atherosclerosis susceptibility & severity.
15528463 We propose that the decreased level of ABCA1 protein is a key factor in the development of atherosclerotic lesions.
15520867 Observational study of gene-disease association. (HuGE Navigator)
15520867 ABC transporter A1 has a role in regulating levels of HDL cholesterol
15500734 Observational study of gene-disease association. (HuGE Navigator)
15492319 ABCA1 is not required for apolipoprotein A-1-mediated endothelial cholesterol efflux from vascular endothelial cells.
15469992 ABCA1 forms a complex with syntaxin 13 and flotillin-1, residing at the plasma membrane and in phagosomes
15358760 SREBP2 down-regulates ATP-binding cassette transporter A1 in vascular endothelial cells
15358117 Serum amyloid A promotes ABCA1-dependent and ABCA1-independent lipid efflux from cells.
15340333 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15297675 Observational study of gene-disease association. (HuGE Navigator)
15297675 tested whether rare sequence variants of ABCA1, APOA1, and LCAT collectively contribute to variation in plasma levels of high density lipoprotein cholesterol; nonsynonymous sequence variants were significantly more common in individuals with low HDL-C
15292375 apoA-I mobilizes intracellular cholesterol for the ABCA1-mediated release from the compartment that is under the control of ACAT. The cholesterol mobilization process is presumably related to PKC activation by apoA-I.
15288432 Observational study of gene-disease association. (HuGE Navigator)
15280376 the majority of ABCA1 exists as a tetramer that binds apoA; the homotetrameric ABCA1 complex constitutes the minimum functional unit required for the biogenesis of high density lipoprotein particles.
15262183 Observational study of gene-disease association. (HuGE Navigator)
15201080 Observational study of gene-disease association. (HuGE Navigator)
15163665 conclude that intact ATP binding cassette transporter A1 (ABCA1) function is necessary for proper maturation of dense bodies in platelets
15158913 Both mutations prevent normal trafficking of ABCA1, thereby explaining their inability to mediate apoA1-dependent lipid efflux
15140889 probucol inactivates ABCA1 in the plasma membrane with respect to its function in mediating binding of and lipid release by apolipoprotein and with respect to proteolytic degradation by calpain
15135251 Observational study of gene-disease association. (HuGE Navigator)
15102890 The reciprocal inhibition of SR-BI and ABCA1 by BLT-4 and glyburide raises the possibility that these proteins may share similar or common steps in their mechanisms of lipid transport.
15066991 ABCA1 is not requied for a positive feedback pathway for stimulation of potentially anti-atherogenic apoE secretion by alpha-helix-containing molecules including apoA-I and apoE
15033469 ATP-binding-cassette transporter A1 gene expression in macrophages is downregulated by statins
15024730 Observational study of gene-disease association. (HuGE Navigator)
15024730 Several single nucleotide polymorphisms spanning the ABCA1 gene modify Alzheimer disease risk.
14993242 ABCA1 does not differentiate between cholesterol and beta-sitosterol and thus is not responsible for the selectivity of sterol absorption by the intestine
14986172 Observational study of gene-disease association. (HuGE Navigator)
14986172 ABCA1 G(-273)C polymorphism has a significant effect on the HDL-C level in the general Japanese population, but not on the incidence of myocardia infarction
14967823 increased palmitate and stearate desaturation by stearoyl-CoA desaturase was associated with the destabilization of ABCA1 by saturated fatty acids palmitate and stearate
14967052 A two step model of cholesterol efflux is suggested that can explain the functional interactions of ABCA1 with apoA-I and other cholesterol acceptors, based on formation of a tight complex between ABCA1 and its ligands.
14962947 Observational study of gene-disease association. (HuGE Navigator)
14962947 Two polymorphisms were associated with plasma levels of ApoA1, 1 in the promoter (C-564T) and 1 in the coding (R1587K) regions, whereas only 1 polymorphism (R219K) was associated with the risk of myocardial infarction.
14767869 Observational study of gene-disease association. (HuGE Navigator)
14767869 the K219 allele of the ABCA1 gene is an anti-atherogenic allele with increased cholesterol efflux activity
14754908 ABCA1 is essential for the biogenesis of high density-sized lipoprotein containing only apoE particles in vivo
14747463 ABCA1 converts pools of late endocytic lipids that retain NPC1 to pools that can associate with endocytosed apoA-I, and be released from the cell as nascent high density lipoprotein
14734645 ApoA-1 removes excess cholesterol & phospholipids from macrophages by an active pathway involving ABCA1. The slow component of this efflux is the ABCA1-dependent process.
14701850 an amphiphilic helical motif is the minimum structural requirement for a protein to stabilize ABCA1 against proteolytic degradation
14701824 the ABCA1 transporter has a role in cellular cAMP signaling with Apolipoprotein A-I
14701812 HDL(3) promotes ABCA1-mediated lipid efflux entirely through its lipid-poor fraction with pre-beta mobility
14681836 first demonstration of an association between ATP-binding cassette, sub-family A member 1 gene expression and fasting glucose concentration in vivo
14668333 results suggest that the interaction of apolipoproteins with ATP binding cassette transporter A1(ABCA1)-expressing cells activates JAK2 which enhances apolipoprotein interactions with ABCA1 and lipid removal from cells
14660648 association of apolipoprotein A-I with lipids reduces its ability to interact with ATP-binding cassette transporter A1(ABCA1) and the lipid translocase activity of ABCA1 generates alpha-LpA-I-like particles
14644402 Of special interest was our finding that the effects of compromised ABCA1 function on HDL were more pronounced in women than in men.
14576201 ABCA1 gene sequence in a proband with very low HDL cholesterol and premature coronary heart disease family history revealed 2 mutations: G5947A (R1851Q) and single thymidine deletion in a polypyrimidine tract 33 to 46 bps upstream from start of exon 47
14570867 ABCA7 compensates the function of ABCA1 for release of cell cholesterol in a certain condition(s).
14560020 These studies indicate a direct role of retinoic acid receptor gamma/retinoid x receptor in induction of macrophage ABCA1.
12952980 ABCA1 is phosphorylated and stabilized in a pathway in which apoA-I activates PKC alpha by PC-PLC-mediated generation of diacylglycerol
12928428 ABCA1-mediated vesicle release involves lipid raft plasma membrane domains
12870173 Observational study of gene-disease association. (HuGE Navigator)
12870173 results indicate that the K219 allele frequency of adenosine triphosphate binding cassette transporter 1 differs markedly between blacks and whites
12869555 Phosphorylation of a pest sequence in ABCA1 promotes calpain degradation and is reversed by ApoA-I.
12860256 Observational study of gene-disease association. (HuGE Navigator)
12813037 ABCA1 has a role in the low levels of HDL-cholesterol and overaccumulation of cellular lipids in Niemann-Pick Disease type C
12804586 regulation of ABCA1 mRNA levels exploits the use of alternative transcription start sites
12763760 In this study we review how genetic variation at the ABCA1 locus affects its role in the maintenance of lipid homeostasis and the natural progression of atherosclerosis.
12730295 hepatic overexpression of ABCA1 showed a selective increase in HDL cholesterol
12709788 Observational study of gene-disease association. (HuGE Navigator)
12709788 While genotype-phenotype associations were not reproduced across populations and loci, V825I and M883I were clearly associated with coronary artery disease status in Malays with no effects on HDL-C or apoA1.
12706378 ABCA1 expression varies among tissues, and cholesterol conversion to hydroxycholesterol is an important mechanism for the maintenance of cholesterol homeostasis in fibroblasts
12700893 Observational study of gene-disease association. (HuGE Navigator)
12624133 Observational study of gene-disease association. (HuGE Navigator)
12624133 The K allele was significantly more frequent in FH subjects without premature CHD than in FH subjects with premature CHD suggesting that the genetic variant R219K in ABCA1 could influence the development and progression of atherosclerosis in FH subjects.
12615681 Review. Transgenic mice with human ABCA1 genes are used to study its function in cholesterol transport, apo B lipoproteins, and atherosclerosis.
12600975 Observational study of gene-disease association. (HuGE Navigator)
12600718 Genetic variability of ABCA1 influences development of Alzheimer's disease,possibly by interfering with CNS cholesterol homeostasis.
12576507 Results describe two new point mutations of the ABCA1 gene found in one patient with Tangier disease and the sibling of another Tangier disease patient.
12562845 examine the necessary structural features for a protein to promote lipid efflux by the ABCA1 transporter and find the amphipathic helix is a key structural motif for peptide-mediated lipid efflux from ABCA1, but there is no stereoselective requirement
12551894 Golgi is involved in ABCA1-mediated cholesterol efflux.
12535741 Observational study of gene-disease association. (HuGE Navigator)
12511593 ABCA1 is regulated by PEST sequence-mediated calpain proteolysis that appears to be reversed by apolipoprotein-mediated phospholipid efflux
12426219 ABCA1 plays an important role in artery wall cell-mediated modification/oxidation of LDL by modulating the release of reactive oxygen species from artery wall cells that are necessary for LDL oxidation.
12359250 findings suggest an important role for hepatocyte basolateral membrane ABCA1 in the regulation of the levels of intracellular hepatic cholesterol, as well as plasma HDL
12235128 The association of FADD with ABCA1 provides an unexpected link between high density lipoprotein metabolism and an adaptor molecule mainly described in death receptor signal transduction.
12204794 Recent data confirms that a single defective allele in ABCA1 may be assosiated with reduced HDL cholesterol and FHA.
12196520 A novel serine (Ser-2054) on the ABCA1 protein crucial for PKA phosphorylation and for regulation of ABCA1 transporter activity.
12176027 Dominant expression of ABCA1 on basolateral surface of Caco-2 cells stimulated by LXR/RXR ligands
12151852 REVIEW: ATP-binding cassette transporter A1 and cholesterol trafficking
12111371 R1680W mutation associated with Tangier disease, phenotypes variable.
12093886 Increased ABCA1 activity protects against atherosclerosis. ABCA1(human transgenic)(+)ApoE(-/-) mice developed dramatically smaller, less-complex lesions as compared with their ApoE(-/-) counterparts.
12084722 ABCA1 mutations can disrupt its direct interaction with apolipoprotein A-I.
11950847 Helical apolipoproteins stabilize ATP-binding cassette transporter A1 by protecting it from thiol protease-mediated degradation.
11940086 Observational study of gene-disease association. (HuGE Navigator)
11940086 ABCA1 regulatory variants influence coronary artery disease independent of effects on plasma lipid levels
11929608 Apo AI/ABCA1-dependent and HDL3-mediated lipid efflux
11893753 Role as a phosphatidylserine translocase
11861672 a novel site in the human ABCA1 promoter involved in the regulation of ABCA1 gene expression.
11855831 contributes to the secretion of interleukin 1beta from macrophages
11809185 Observational study of gene-disease association. (HuGE Navigator)
11752403 in the presence of apoE, overexpression of ABCA1 modulates HDL as well as apoB-containing lipoprotein metabolism and reduces atherosclerosis in vivo
11700048 function as a regulator rather than an active transporter
11349008 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11257261 Observational study of gene-disease association. (HuGE Navigator)
11238261 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MACWPQLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWV      1 - 70
QGIICNANNPCFRYPTPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSS     71 - 140
NLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQE    141 - 210
VSELCGLPREKLAAAERVLRSNMDILKPILRTLNSTSPFPSKELAEATKTLLHSLGTLAQELFSMRSWSD    211 - 280
MRQEVMFLTNVNSSSSSTQIYQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNGTEEDAETFYDNS    281 - 350
TTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELS    351 - 420
PKIWTFMENSQEMDLVRMLLDSRDNDHFWEQQLDGLDWTAQDIVAFLAKHPEDVQSSNGSVYTWREAFNE    421 - 490
TNQAIRTISRFMECVNLNKLEPIATEVWLINKSMELLDERKFWAGIVFTGITPGSIELPHHVKYKIRMDI    491 - 560
DNVERTNKIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGTEKKTGVYMQQMPYPCYVDD    561 - 630
IFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLL    631 - 700
VVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDY    701 - 770
VGFTLKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTW    771 - 840
YIEAVFPGQYGIPRPWYFPCTKSYWFGEESDEKSHPGSNQKRISEICMEEEPTHLKLGVSIQNLVKVYRD    841 - 910
GMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQ    911 - 980
HNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGG    981 - 1050
SKVVILDEPTAGVDPYSRRGIWELLLKYRQGRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKN   1051 - 1120
QLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKH   1121 - 1190
VSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAE   1191 - 1260
TSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFV   1261 - 1330
ALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQYTFVSNDAPEDTG   1331 - 1400
TLELLNALTKDPGFGTRCMEGNPIPDTPCQAGEEEWTTAPVPQTIMDLFQNGNWTMQNPSPACQCSSDKI   1401 - 1470
KKMLPVCPPGAGGLPPPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVS   1471 - 1540
NTQALPPSQEVNDAIKQMKKHLKLAKDSSADRFLNSLGRFMTGLDTKNNVKVWFNNKGWHAISSFLNVIN   1541 - 1610
NAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQER   1611 - 1680
VSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSIT   1681 - 1750
PLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTDNKLNNINDILKSVFLIFPHFCLGRGLI   1751 - 1820
DMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVNAKLSPLND   1821 - 1890
EDEDVRRERQRILDGGGQNDILEIKELTKIYRRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLT   1891 - 1960
GDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIR   1961 - 2030
KLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLT   2031 - 2100
SHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQDFFGLAFPGSVLKE   2101 - 2170
KHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQSDDDHLKDLSLHKNQT   2171 - 2240
VVDVAVLTSFLQDEKVKESYV                                                    2241 - 2261
//

Text Mined References (629)

PMID Year Title
27239842 [Role of the ABC transporters A1 and G1, key reverse cholesterol transport proteins, in atherosclerosis].
26891315 2016 Association between Polymorphisms and Haplotype in the ABCA1 Gene and Overweight/Obesity Patients in the Uyghur Population of China.
26828509 2016 Interactions of Six SNPs in ABCA1gene and Obesity in Low HDL-C Disease in Kazakh of China.
26791180 2016 Interaction of methylation-related genetic variants with circulating fatty acids on plasma lipids: a meta-analysis of 7 studies and methylation analysis of 3 studies in the Cohorts for Heart and Aging Research in Genomic Epidemiology consortium.
26776055 2016 Eicosapentaenoic acid membrane incorporation impairs ABCA1-dependent cholesterol efflux via a protein kinase A signaling pathway in primary human macrophages.
26774504 2016 Correlation Between ABCA1 Gene Polymorphism and aopA-I and HDL-C in Abdominal Aortic Aneurysm.
26772887 2016 Cystathionine ?-lyase(CSE)/hydrogen sulfide system is regulated by miR-216a and influences cholesterol efflux in macrophages via the PI3K/AKT/ABCA1 pathway.
26722555 2015 Association of ATP-binding cassette transporter A1 gene polymorphisms with plasma lipid variability and coronary heart disease risk.
26718613 2016 MicroRNA 28-5p regulates ATP-binding cassette transporter A1 via inhibiting extracellular signal-regulated kinase 2.
26681752 2016 Niacin Therapy Increases High-Density Lipoprotein Particles and Total Cholesterol Efflux Capacity But Not ABCA1-Specific Cholesterol Efflux in Statin-Treated Subjects.
26617799 2015 Quercetin increases macrophage cholesterol efflux to inhibit foam cell formation through activating PPAR?-ABCA1 pathway.
26608582 2016 ABCA1 rs1883025 polymorphism and risk of age-related macular degeneration.
26592663 2016 Impact of age and sex on the development of atherosclerosis and expression of the related genes in apoE deficient mice.
26497474 2016 ABCA1-dependent sterol release: sterol molecule specificity and potential membrane domain for HDL biogenesis.
26451383 2015 Association of ATP-Binding Cassette Transporter A1 Gene Polymorphisms in Type 2 Diabetes Mellitus among Malaysians.
26431478 2015 Evaluation of the Association Between Common Genetic Variants Near the ABCA1 Gene and Primary Angle Closure Glaucoma in a Han Chinese Population.
26322417 2015 The polyphenol PGG enhances expression of SR-BI and ABCA1 in J774 and THP-1 macrophages.
26261553 2015 Lipoxin A4 promotes ABCA1 expression and cholesterol efflux through the LXR? signaling pathway in THP-1 macrophage-derived foam cells.
26243156 2015 Functional and Structural Impact of ATP-Binding Cassette Transporter A1 R219K and I883M Gene Polymorphisms in Obese Children and Adolescents.
26102194 2015 Curcumin enhanced cholesterol efflux by upregulating ABCA1 expression through AMPK-SIRT1-LXR? signaling in THP-1 macrophage-derived foam cells.
26090796 2015 Association between the ABCA1-565C/T gene promoter polymorphism and coronary heart disease severity and cholesterol efflux in the Chinese Han population.
26079414 2015 Loss-of-function mutation in ABCA1 and risk of Alzheimer's disease and cerebrovascular disease.
26073400 Myocardial infarction in a 36-year-old man with combined ABCA1 and APOA-1 deficiency.
26051418 2015 Asymptomatic individuals with high HDL-C levels overexpress ABCA1 and ABCG1 and present miR-33a dysregulation in peripheral blood mononuclear cells.
26045826 2015 ABCA1 mRNA expression and cholesterol outflow in U937 cells.
26004638 2015 Low Serum Levels of ABCA1, an ATP-Binding Cassette Transporter, Are Predictive of Preeclampsia.
25877294 2015 ATP-binding cassette transporter A1 (ABCA1) R219K (G1051A, rs2230806) polymorphism and serum high-density lipoprotein cholesterol levels in a large Japanese population: cross-sectional data from the Daiko Study.
25875382 2015 Whole exome sequencing combined with integrated variant annotation prediction identifies asymptomatic Tangier disease with compound heterozygous mutations in ABCA1 gene.
25852127 2015 Lipoprotein (a) upregulates ABCA1 in liver cells via scavenger receptor-B1 through its oxidized phospholipids.
25839936 2015 Diabetes susceptibility in Mayas: Evidence for the involvement of polymorphisms in HHEX, HNF4?, KCNJ11, PPAR?, CDKN2A/2B, SLC30A8, CDC123/CAMK1D, TCF7L2, ABCA1 and SLC16A11 genes.
25765596 2015 Diosgenin inhibits atherosclerosis via suppressing the MiR-19b-induced downregulation of ATP-binding cassette transporter A1.
25761370 2015 Inhibition of ABCA1 protein degradation promotes HDL cholesterol efflux capacity and RCT and reduces atherosclerosis in mice.
25744199 2015 ABCA1 expression in macrophages of allogeneic hematopoietic stem cell transplantation patients with severe infection undergoing continuous blood purification.
25734982 2015 A novel compound 4010B-30 upregulates apolipoprotein A-I gene expression through activation of PPAR? in HepG2 cells.
25733328 2015 Methyl protodioscin increases ABCA1 expression and cholesterol efflux while inhibiting gene expressions for synthesis of cholesterol and triglycerides by suppressing SREBP transcription and microRNA 33a/b levels.
25704294 2015 miR-28-5p Involved in LXR-ABCA1 Pathway is Increased in the Plasma of Unstable Angina Patients.
25665932 2015 Preferential incorporation of shorter and less unsaturated acyl phospholipids into high density lipoprotein-like particles in the ABCA1- and ABCA7-mediated biogenesis with apoA-I.
25616132 2015 RIP140 triggers foam-cell formation by repressing ABCA1/G1 expression and cholesterol efflux via liver X receptor.
25600616 Propofol up-regulates expression of ABCA1, ABCG1, and SR-B1 through the PPAR?/LXR? signaling pathway in THP-1 macrophage-derived foam cells.
25589556 2015 HDL particle size is a critical determinant of ABCA1-mediated macrophage cellular cholesterol export.
25579789 2015 Position 834 in TM6 plays an important role in cholesterol and phosphatidylcholine transport by ABCA1.
25527331 2015 ATP-binding cassette transporter 1 C69T and V825I polymorphisms in the development of atherosclerosis: a meta-analysis of 18,320 subjects.
25486791 2013 [ABCA1 mRNA and protein levels in M-CSF-activated macrophages from patients with arterial stenosis].
25445880 2015 Identification of microRNAs 758 and 33b as potential modulators of ABCA1 expression in human atherosclerotic plaques.
25415591 2014 Akt inhibition promotes ABCA1-mediated cholesterol efflux to ApoA-I through suppressing mTORC1.
25413254 2015 In type 2 diabetes mellitus glycated albumin alters macrophage gene expression impairing ABCA1-mediated cholesterol efflux.
25359426 ABCA1 and nascent HDL biogenesis.
25339370 2015 MicroRNA-106a confers cisplatin resistance in non-small cell lung cancer A549 cells by targeting adenosine triphosphatase-binding cassette A1.
25302608 2014 ABCA1, ABCG1, and ABCG4 are distributed to distinct membrane meso-domains and disturb detergent-resistant domains on the plasma membrane.
25280398 2015 Pioglitazone reduces lipid droplets in cholesterolosis of the gallbladder by increasing ABCA1 and NCEH1 expression.
25225013 2014 Angiotensin-(1-7) upregulates expression of adenosine triphosphate-binding cassette transporter A1 and adenosine triphosphate-binding cassette transporter G1 through the Mas receptor through the liver X receptor alpha signalling pathway in THP-1 macrophages treated with angiotensin-II.
25223800 2014 Urotensin II increases foam cell formation by repressing ABCA1 expression through the ERK/NF-?B pathway in THP-1 macrophages.
25198127 2014 HIV-1 infection of macrophages induces retention of cholesterol transporter ABCA1 in the endoplasmic reticulum.
25194807 2014 Interleukin-27 inhibits foam cell formation by promoting macrophage ABCA1 expression through JAK2/STAT3 pathway.
25181357 2014 Cellular cholesterol transport proteins in diabetic nephropathy.
25173107 2014 Common variants near ABCA1 and in PMM2 are associated with primary open-angle glaucoma.
25173106 2014 Genome-wide analysis of multi-ancestry cohorts identifies new loci influencing intraocular pressure and susceptibility to glaucoma.
25173105 2014 Common variants near ABCA1, AFAP1 and GMDS confer risk of primary open-angle glaucoma.
25170080 2014 HIV-1 protein Nef inhibits activity of ATP-binding cassette transporter A1 by targeting endoplasmic reticulum chaperone calnexin.
25125487 2015 Loss-of-function mutations in ABCA1 and enhanced ?-cell secretory capacity in young adults.
25121365 Association of polymorphisms of CYP2C9, CYP2C19, and ABCB1, and activity of P-glycoprotein with response to anti-epileptic drugs.
25110219 Increased risk of premature coronary artery disease in Egyptians with ABCA1 (R219K), CETP (TaqIB), and LCAT (4886C/T) genes polymorphism.
25104170 2015 The R219K polymorphism on ATP-binding cassette transporter A1 gene is associated with coronary heart disease risk in Asia population: evidence from a meta-analysis.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
25084135 2014 MicroRNA-19b promotes macrophage cholesterol accumulation and aortic atherosclerosis by targeting ATP-binding cassette transporter A1.
25028266 2014 ABC transporters as differentiation markers in glioblastoma cells.
25027185 2014 Effects of R219K polymorphism of ATP-binding cassette transporter 1 gene on serum lipids ratios induced by a high-carbohydrate and low-fat diet in healthy youth.
25001295 2015 Attenuated macrophage cholesterol efflux function in patients with obstructive sleep apnea-hypopnea syndrome.
24992457 2014 ATP-binding cassette transporter A1: key player in cardiovascular and metabolic disease at local and systemic level.
24970616 2014 The contribution of genetic factors to phenotype and progression of drusen in early age-related macular degeneration.
24942079 2014 ABCA1 rs4149313 polymorphism and susceptibility to coronary heart disease: a meta-analysis.
24854628 2014 ABCA1 gene variation and heart disease risk reduction in the elderly during pravastatin treatment.
24842300 2014 Adrenal Function in females with low plasma HDL-C due to mutations in ABCA1 and LCAT.
24814410 2014 7-ketocholesteryl-9-carboxynonanoate enhances ATP binding cassette transporter A1 expression mediated by PPAR? in THP-1 macrophages.
24813055 2014 ATP-binding cassette transporter 1 attenuates ovalbumin-induced neutrophilic airway inflammation.
24801727 2014 Caveolin-1 and ATP binding cassette transporter A1 and G1-mediated cholesterol efflux.
24796288 2015 Peripheral Blood Mononuclear Cell ABCA1 Transcripts and Protein Expression in Acute Myocardial Infarction.
24793484 2014 ApoA-I or ABCA1 expression suppresses fatty acid synthesis by reducing 27-hydroxycholesterol levels.
24751522 2014 miR-613 regulates cholesterol efflux by targeting LXR? and ABCA1 in PPAR? activated THP-1 macrophages.
24735204 2014 FGF21 increases cholesterol efflux by upregulating ABCA1 through the ERK1/2-PPAR?-LXR? pathway in THP1 macrophage-derived foam cells.
24722912 2014 Oleic acid modulates mRNA expression of liver X receptor (LXR) and its target genes ABCA1 and SREBP1c in human neutrophils.
24685762 2014 ABCA1 rs1883025 polymorphism shows no association with neovascular age-related macular degeneration or polypoidal choroidal vasculopathy in a Northern Chinese population.
24680682 2014 Early senescence in heterozygous ABCA1 mutation skin fibroblasts: a gene dosage effect beyond HDL deficiency?
24646941 2014 Up-regulation of the ATP-binding cassette transporter A1 inhibits hepatitis C virus infection.
24636347 2014 Enhanced cholesterol efflux to HDL through the ABCA1 transporter in hypertriglyceridemia of type 2 diabetes.
24629160 2014 LDL is out again - through the crosstalk of two atheroprotective mechanisms: ABCA1 of macrophages and NO? from endothelial cells.
24500716 2014 Cellular cholesterol regulates ubiquitination and degradation of the cholesterol export proteins ABCA1 and ABCG1.
24493833 2014 A lincRNA-DYNLRB2-2/GPR119/GLP-1R/ABCA1-dependent signal transduction pathway is essential for the regulation of cholesterol homeostasis.
24466114 2014 Influence of ATP-binding cassette transporter 1 R219K and M883I polymorphisms on development of atherosclerosis: a meta-analysis of 58 studies.
24462860 2014 Growth differentiation factor-15 induces expression of ATP-binding cassette transporter A1 through PI3-K/PKC?/SP1 pathway in THP-1 macrophages.
24406162 2014 The ABCA1 domain responsible for interaction with HIV-1 Nef is conformational and not linear.
24394674 2014 Imbalanced response of ATP-binding cassette transporter A1 and CD36 expression to increased oxidized low-density lipoprotein loading contributes to the development of THP-1 derived foam cells.
24376512 2013 Gene-gene combination effect and interactions among ABCA1, APOA1, SR-B1, and CETP polymorphisms for serum high-density lipoprotein-cholesterol in the Japanese population.
24296892 2013 ABCA1 C69T gene polymorphism and risk of type 2 diabetes mellitus in a Saudi population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24157307 2014 ATP-binding cassette transporter A1 R219K polymorphism and ischemic stroke risk in the Chinese population: a meta-analysis.
24135019 2013 Regulation of ABCA1 protein expression and function in hepatic and pancreatic islet cells by miR-145.
24113149 2013 Adaptations of placental and cord blood ABCA1 DNA methylation profile to maternal metabolic status.
24097981 2013 Differential phospholipid substrates and directional transport by ATP-binding cassette proteins ABCA1, ABCA7, and ABCA4 and disease-causing mutants.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24081377 2014 The role of ABCA1 gene sequence variants on risk of Alzheimer's disease.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23999864 2013 Hormonal modulators of glial ABCA1 and apoE levels.
23990020 2013 Pro-apoptotic miRNA-128-2 modulates ABCA1, ABCG1 and RXR? expression and cholesterol homeostasis.
23931754 2013 ABCA12 regulates ABCA1-dependent cholesterol efflux from macrophages and the development of atherosclerosis.
23880356 2013 Placental ABCA1 and ABCG1 expression in gestational disease: Pre-eclampsia affects ABCA1 levels in syncytiotrophoblasts.
23868939 2013 Novel formulation of a reconstituted high-density lipoprotein (CSL112) dramatically enhances ABCA1-dependent cholesterol efflux.
23739547 2013 Tertiary-butylhydroquinone upregulates expression of ATP-binding cassette transporter A1 via nuclear factor E2-related factor 2/heme oxygenase-1 signaling in THP-1 macrophage-derived foam cells.
23707398 ABC-cassette transporter 1 (ABCA1) expression in epithelial cells in Chlamydia pneumoniae infection.
23705956 2013 Posttranscriptional regulation of ATP-binding cassette transporter A1 in lipid metabolism.
23656756 2013 Single nucleotide polymorphisms in CETP, SLC46A1, SLC19A1, CD36, BCMO1, APOA5, and ABCA1 are significant predictors of plasma HDL in healthy adults.
23620136 2013 Helical domains that mediate lipid solubilization and ABCA1-specific cholesterol efflux in apolipoproteins C-I and A-II.
23598720 2013 PPAR? promotes oncogenic redirection of TGF-?1 signaling through the activation of the ABCA1-Cav1 pathway.
23582768 2013 Protein tyrosine phosphatase inhibition down-regulates ligand-induced ABCA1 expression.
23564066 2013 Neopterin negatively regulates expression of ABCA1 and ABCG1 by the LXR? signaling pathway in THP-1 macrophage-derived foam cells.
23543682 2013 Factors controlling nascent high-density lipoprotein particle heterogeneity: ATP-binding cassette transporter A1 activity and cell lipid and apolipoprotein AI availability.
23519696 2013 MicroRNA-144 regulates hepatic ATP binding cassette transporter A1 and plasma high-density lipoprotein after activation of the nuclear receptor farnesoid X receptor.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23479619 2013 ABCA1 dimer-monomer interconversion during HDL generation revealed by single-molecule imaging.
23402987 2013 MCP-1 impacts RCT by repressing ABCA1, ABCG1, and SR-BI through PI3K/Akt posttranslational regulation in HepG2 cells.
23381994 2013 Promoter polymorphisms in the ATP binding cassette transporter gene influence production of cell-derived microparticles and are highly associated with susceptibility to severe malaria in humans.
23305686 2013 Homocysteine-mediated cholesterol efflux via ABCA1 and ACAT1 DNA methylation in THP-1 monocyte-derived foam cells.
23275468 2013 ATP-binding cassette transporter A1 expression is decreased in preeclamptic placentas.
23273975 2013 The R230C variant of the ATP binding cassette protein A1 (ABCA1) gene is associated with a decreased response to glyburide therapy in patients with type 2 diabetes mellitus.
23233737 2013 Dysregulation of cholesterol homeostasis in human prostate cancer through loss of ABCA1.
23220274 2013 BIG1, a brefeldin A-inhibited guanine nucleotide-exchange protein modulates ATP-binding cassette transporter A-1 trafficking and function.
23204179 2013 The expression of cholesterol metabolism genes in monocytes from HIV-infected subjects suggests intracellular cholesterol accumulation.
23181436 2012 Association studies of several cholesterol-related genes (ABCA1, CETP and LIPC) with serum lipids and risk of Alzheimer's disease.
23179156 2013 ATP-binding cassette sterol transporters are differentially expressed in normal and diseased human gallbladder.
23152888 2012 The ABCA1 gene R230C variant is associated with decreased risk of premature coronary artery disease: the genetics of atherosclerotic disease (GEA) study.
23139370 2012 ABC transporter genes and risk of type 2 diabetes: a study of 40,000 individuals from the general population.
23136402 2013 ABCA1 mutation carriers with low high-density lipoprotein cholesterol are characterized by a larger atherosclerotic burden.
23132909 2013 ApoA-IV promotes the biogenesis of apoA-IV-containing HDL particles with the participation of ABCA1 and LCAT.
23111454 2013 Quantitative assessment of the effect of ABCA1 gene polymorphism on the risk of Alzheimer's disease.
23109900 2012 Several lipid-related gene polymorphisms interact with overweight/obesity to modulate blood pressure levels.
23103472 2013 ABCA1-dependent serum cholesterol efflux capacity inversely correlates with pulse wave velocity in healthy subjects.
23053993 2012 ATP-binding cassette transporter A1 R219K polymorphism and coronary artery disease in Chinese population: a meta-analysis of 5,388 participants.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
22984509 2012 Apolipoprotein E4 is deficient in inducing macrophage ABCA1 expression and stimulating the Sp1 signaling pathway.
22982414 2012 Meta-analysis on association between the ATP-binding cassette transporter A1 gene (ABCA1) and Alzheimer's disease.
22981231 2012 Anticancer activity of the cholesterol exporter ABCA1 gene.
22959828 2012 Novel mutations of ABCA1 transporter in patients with Tangier disease and familial HDL deficiency.
22929031 2013 Maternal ABCA1 genotype is associated with severity of Smith-Lemli-Opitz syndrome and with viability of patients homozygous for null mutations.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22913458 2012 Release of lysophospholipid 'find-me' signals during apoptosis requires the ATP-binding cassette transporter A1.
22750655 2012 Nascent high density lipoproteins formed by ABCA1 resemble lipid rafts and are structurally organized by three apoA-I monomers.
22672264 2012 Host HDL biogenesis machinery is recruited to the inclusion of Chlamydia trachomatis-infected cells and regulates chlamydial growth.
22668585 2012 Association of gender, ABCA1 gene polymorphisms and lipid profile in Greek young nurses.
22614118 2012 The transcription levels of ABCA1, ABCG1 and SR-BI are negatively associated with plasma CRP in Chinese populations with various risk factors for atherosclerosis.
22610793 2013 S-Allylcysteine, a garlic compound, increases ABCA1 expression in human THP-1 macrophages.
22584245 2013 Cholesteryl ester transfer protein and ATP-binding cassette transporter A1 genotype alter the atorvastatin and simvastatin efficacy: time for genotype-guided therapy?
22516753 2012 ABCA1 upregulating apolipoproein M expression mediates via the RXR/LXR pathway in HepG2 cells.
22503545 2012 PAPP-A negatively regulates ABCA1, ABCG1 and SR-B1 expression by inhibiting LXR? through the IGF-I-mediated signaling pathway.
22498566 2012 Interleukin-18 and interleukin-12 together downregulate ATP-binding cassette transporter A1 expression through the interleukin-18R/nuclear factor-?B signaling pathway in THP-1 macrophage-derived foam cells.
22466164 2012 Associations of ATP-binding cassette transporter A1 and G1 with insulin secretion in human insulinomas.
22425645 2012 The impact of severe LDL receptor mutations on SREBP-pathway regulation in homozygous familial hypercholesterolemia (FH).
22419126 2012 ABCA1 gene promoter DNA methylation is associated with HDL particle profile and coronary artery disease in familial hypercholesterolemia.
22418575 2012 The role of HDL and its modulators in the development of diabetes.
22399527 2012 Genome-wide screen for metabolic syndrome susceptibility Loci reveals strong lipid gene contribution but no evidence for common genetic basis for clustering of metabolic syndrome traits.
22389325 2012 Niacin increases HDL biogenesis by enhancing DR4-dependent transcription of ABCA1 and lipidation of apolipoprotein A-I in HepG2 cells.
22384526 2012 Investigation of ABCA1 C69T polymorphism in patients with type 2 diabetes mellitus.
22377775 2012 The polymorphism of the ATP-binding cassette transporter 1 gene modulates Alzheimer disease risk in Chinese Han ethnic population.
22315319 2012 miR-33a modulates ABCA1 expression, cholesterol accumulation, and insulin secretion in pancreatic islets.
22311493 2012 [Association between -14 bp and ZNF polymorphisms of ABCA1 gene promoter and high density lipoprotein cholesterol level and cardiovascular disease].
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22282358 2012 HNF4? increases liver-specific human ATP-binding cassette transporter A1 expression and cholesterol efflux to apolipoprotein A-I in response to cholesterol depletion.
22271762 2012 Endogenous apolipoprotein A-I stabilizes ATP-binding cassette transporter A1 and modulates Toll-like receptor 4 signaling in human macrophages.
22262807 2012 HIV-1 Nef mobilizes lipid rafts in macrophages through a pathway that competes with ABCA1-dependent cholesterol efflux.
22248050 2012 Lipid-bound apolipoproteins in tyrosyl radical-oxidized HDL stabilize ABCA1 like lipid-free apolipoprotein A-I.
22190032 2012 Carbohydrate intake modulates the effect of the ABCA1-R230C variant on HDL cholesterol concentrations in premenopausal women.
22178419 2012 Impairment of the ABCA1 and SR-BI-mediated cholesterol efflux pathways and HDL anti-inflammatory activity in Alzheimer's disease.
22170052 2012 Up-regulation of ATP binding cassette transporter A1 expression by very low density lipoprotein receptor and apolipoprotein E receptor 2.
22119192 2012 MiR-106b impairs cholesterol efflux and increases A? levels by repressing ABCA1 expression.
22074701 2012 Deleterious impact of elaidic fatty acid on ABCA1-mediated cholesterol efflux from mouse and human macrophages.
22035022 2011 Effect Of G2706A and G1051A polymorphisms of the ABCA1 gene on the lipid, oxidative stress and homocystein levels in Turkish patients with polycyst?c ovary syndrome.
22028339 2012 ATP hydrolysis-dependent conformational changes in the extracellular domain of ABCA1 are associated with apoA-I binding.
21951852 2011 Interaction abolishment between mutant caveolin-1(?62-100) and ABCA1 reduces HDL-mediated cellular cholesterol efflux.
21920460 2012 Regulation of ABCA1 functions by signaling pathways.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21885853 2011 MicroRNA-758 regulates cholesterol efflux through posttranscriptional repression of ATP-binding cassette transporter A1.
21875686 2012 Increased risk of coronary artery disease in Caucasians with extremely low HDL cholesterol due to mutations in ABCA1, APOA1, and LCAT.
21860089 2011 Wild type and Tangier disease ABCA1 mutants modulate cellular amyloid-? production independent of cholesterol efflux activity.
21846716 2011 Membrane microdomains modulate oligomeric ABCA1 function: impact on apoAI-mediated lipid removal and phosphatidylcholine biosynthesis.
21840005 2011 ABCA1 impacts athero-thrombotic risk and 10-year survival in a contemporary secondary prevention setting.
21839797 2011 A polymorphism of the ABCA1 gene confers susceptibility to schizophrenia and related brain changes.
21829447 2011 Type 2 diabetes is associated with reduced ATP-binding cassette transporter A1 gene expression, protein and function.
21817095 2011 Proteasomal inhibition promotes ATP-binding cassette transporter A1 (ABCA1) and ABCG1 expression and cholesterol efflux from macrophages in vitro and in vivo.
21763656 2011 Homology modeling and functional testing of an ABCA1 mutation causing Tangier disease.
21757691 2011 Lysosomal acid lipase deficiency impairs regulation of ABCA1 gene and formation of high density lipoproteins in cholesteryl ester storage disease.
21749932 2012 Lysine residues of ABCA1 are required for the interaction with apoA-I.
21740892 2011 Possibility of increasing cholesterol efflux by adiponectin and its receptors through the ATP binding cassette transporter A1 in HEK293T cells.
21734188 2011 Human apolipoprotein A-I induces cyclooxygenase-2 expression and prostaglandin I-2 release in endothelial cells through ATP-binding cassette transporter A1.
21677398 2011 Association of ATP-binding cassette transporter-A1 polymorphism with apolipoprotein AI level in Tehranian population.
21643759 2012 Quantitative assessment of the effect of ABCA1 R219K polymorphism on the risk of coronary heart disease.
21634116 [ABCA1 gene expression in peripheral blood lymphocytes and macrophages in patients with atherosclerosis].
21613373 2011 Evaluation of serum lipid concentrations and genetic variants at high-density lipoprotein metabolism loci and TIMP3 in age-related macular degeneration.
21605865 2011 Thyroid hormone enhances the ability of serum to accept cellular cholesterol via the ABCA1 transporter.
21601208 2011 Genetic variation in ABCA1 and risk of cardiovascular disease.
21591583 2011 Differential effect of ATP binding cassette transporter A1 R219K and cholesteryl ester transfer protein TaqIB genotypes on HDL-C levels in overweight/obese and non-obese Chinese subjects.
21575609 2011 An ABCA1 truncation shows no dominant negative effect in a familial hypoalphalipoproteinemia pedigree with three ABCA1 mutations.
21530801 2011 Unsaturated fatty acids repress the expression of ATP-binding cassette transporter A1 in HepG2 and FHs 74 Int cells.
21507939 2011 Liver X receptor beta (LXRbeta) interacts directly with ATP-binding cassette A1 (ABCA1) to promote high density lipoprotein formation during acute cholesterol accumulation.
21501868 2011 Expression and localization pattern of ABCA1 in diverse human placental primary cells and tissues.
21501700 2011 Impact of HDL oxidation by the myeloperoxidase system on sterol efflux by the ABCA1 pathway.
21489276 2011 ATP-binding cassette transporter A1 gene polymorphisms and serum lipid levels in young Greek nurses.
21478209 2011 Lack of association between circulating levels of oxidized LDL/beta2-glycoprotein I complexes and leukocyte ABCA1 gene expression.
21447678 2011 Association of variants in the LIPC and ABCA1 genes with intermediate and large drusen and advanced age-related macular degeneration.
21389634 2011 ABC proteins protect the human body and maintain optimal health.
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
21339300 2011 Tristetraprolin-dependent post-transcriptional regulation of inflammatory cytokine mRNA expression by apolipoprotein A-I: role of ATP-binding membrane cassette transporter A1 and signal transducer and activator of transcription 3.
21315358 2011 The non-synonymous Arg230Cys variant (R230C) of the ATP-binding cassette transporter A1 is associated with low HDL cholesterol concentrations in Mexican adults: a population based nation wide study.
21310416 2011 Associations of the ATP-binding cassette transporter A1 R219K polymorphism with HDL-C level and coronary artery disease risk: a meta-analysis.
21300560 2011 Genetic variation of the ATP-binding cassette transporter A1 and susceptibility to coronary heart disease.
21289254 2011 Effect of bariatric surgery-induced weight loss on SR-BI-, ABCG1-, and ABCA1-mediated cellular cholesterol efflux in obese women.
21247457 2011 Genetic variant of V825I in the ATP-binding cassette transporter A1 gene and serum lipid levels in the Guangxi Bai Ku Yao and Han populations.
21130966 2010 Associations between common polymorphisms of adenosine triphosphate-binding cassette transporter A1 and coronary artery disease in a Tunisian population.
21117950 Effect of estrogen receptor ? A1730G polymorphism on ABCA1 gene expression response to postmenopausal hormone replacement therapy.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
21111593 2011 Phytosterols differentially influence ABC transporter expression, cholesterol efflux and inflammatory cytokine secretion in macrophage foam cells.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20951680 2010 PPAR? activates ABCA1 gene transcription but reduces the level of ABCA1 protein in HepG2 cells.
20880529 2010 Identification and characterization of novel loss of function mutations in ATP-binding cassette transporter A1 in patients with low plasma high-density lipoprotein cholesterol.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20835684 2010 [Influence of genetic combinations on HDL-C levels in a Southern Brazilian population].
20807164 2011 Increased leukocyte ABCA1 gene expression in post-menopausal women on hormone replacement therapy.
20800056 2010 Mutations in APOA-I and ABCA1 in Norwegians with low levels of HDL cholesterol.
20797885 Increase in HDL-C concentration by a dietary portfolio with soy protein and soluble fiber is associated with the presence of the ABCA1R230C variant in hyperlipidemic Mexican subjects.
20727372 2011 A single session of circuit-resistance exercise effects on human peripheral blood lymphocyte ABCA1 expression and plasma HDL-C level.
20714348 2010 Common inherited variation in mitochondrial genes is not enriched for associations with type 2 diabetes or related glycemic traits.
20702810 2010 Acidic extracellular environments strongly impair ABCA1-mediated cholesterol efflux from human macrophage foam cells.
20691829 2010 Joint effects of common genetic variants from multiple genes and pathways on the risk of premature coronary artery disease.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20671065 2010 High-density lipoprotein induces proliferation and migration of human prostate androgen-independent cancer cells by an ABCA1-dependent mechanism.
20643408 2010 Transcriptional factor prolactin regulatory element-binding protein-mediated gene transcription of ABCA1 via 3',5'-cyclic adenosine-5'-monophosphate.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20625316 2010 Contribution of D4-F to ABCA1 expression and cholesterol efflux in THP-1 macrophage-derived foam cells.
20595220 2011 A frequent variant in the ABCA1 gene is associated with increased coronary heart disease risk and a better response to statin treatment in familial hypercholesterolemia patients.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20571217 2010 Epistasis between intracellular cholesterol trafficking-related genes (NPC1 and ABCA1) and Alzheimer's disease risk.
20553836 2010 Enhanced expression of ATP-binding cassette transporter A1 in non-rafts decreases the sensitivity of vascular endothelial cells to Shiga toxin.
20506155 2010 Anti-atherogenic effect of berberine on LXRalpha-ABCA1-dependent cholesterol efflux in macrophages.
20485864 ATP-binding membrane cassette transporter A1 (ABCA1): a possible link between inflammation and reverse cholesterol transport.
20472936 2010 ABCA1 promotes the efflux of bacterial LPS from macrophages and accelerates recovery from LPS-induced tolerance.
20430392 2010 No interaction between alcohol consumption and HDL-related genes on HDL cholesterol levels.
20427018 2010 Association of R230C ABCA1 gene variant with low HDL-C levels and abnormal HDL subclass distribution in Mexican school-aged children.
20418488 2010 A functional ABCA1 gene variant is associated with low HDL-cholesterol levels and shows evidence of positive selection in Native Americans.
20413849 2010 Increased ATP-binding cassette transporter A1 expression in Alzheimer's disease hippocampal neurons.
20395597 2010 Calmodulin interacts with ATP binding cassette transporter A1 to protect from calpain-mediated degradation and upregulates high-density lipoprotein generation.
20394740 2010 Interaction of common sequence variants and selected risk factors in determination of HDL cholesterol levels.
20385826 2010 Genome-wide association study of advanced age-related macular degeneration identifies a role of the hepatic lipase gene (LIPC).
20385819 2010 Genetic variants near TIMP3 and high-density lipoprotein-associated loci influence susceptibility to age-related macular degeneration.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378541 2010 Modifying apolipoprotein A-I by malondialdehyde, but not by an array of other reactive carbonyls, blocks cholesterol efflux by the ABCA1 pathway.
20348106 2010 Binding of PDZ-RhoGEF to ATP-binding cassette transporter A1 (ABCA1) induces cholesterol efflux through RhoA activation and prevention of transporter degradation.
20346718 2010 Effect of fenofibrate therapy and ABCA1 polymorphisms on high-density lipoprotein subclasses in the Genetics of Lipid Lowering Drugs and Diet Network.
20338636 2010 Expression and localization of ATP binding cassette transporter A1 (ABCA1) in first trimester and term human placenta.
20303467 2010 The role of ATP-binding-cassette-transporter-A1 (ABCA1) gene polymorphism on coronary artery disease risk.
20227257 2011 Polymorphisms in the platelet-specific collagen receptor GP6 are associated with risk of nonfatal myocardial infarction in Caucasians.
20215580 2010 A novel role for ABCA1-generated large pre-beta migrating nascent HDL in the regulation of hepatic VLDL triglyceride secretion.
20188211 2010 The role of ATP-binding cassette transporter A1 in Alzheimer's disease and neurodegeneration.
20185793 2010 ABCA1 gene variants regulate postprandial lipid metabolism in healthy men.
20173014 2010 17{beta}-Estradiol modulates the macrophage migration inhibitory factor secretory pathway by regulating ABCA1 expression in human first-trimester placenta.
20170916 2010 Association of selected ABC gene family single nucleotide polymorphisms with postprandial lipoproteins: results from the population-based Hortega study.
20167577 2010 Analysis of lipid pathway genes indicates association of sequence variation near SREBF1/TOM1L2/ATPAF2 with dementia risk.
20160193 2010 Investigation of variants identified in caucasian genome-wide association studies for plasma high-density lipoprotein cholesterol and triglycerides levels in Mexican dyslipidemic study samples.
20103810 2010 TNF-alpha decreases ABCA1 expression and attenuates HDL cholesterol efflux in the human intestinal cell line Caco-2.
20101560 2010 Hyperglycemia suppresses ABCA1 expression in vascular smooth muscle cells.
20093111 2010 Multiple abnormally spliced ABCA1 mRNAs caused by a novel splice site mutation of ABCA1 gene in a patient with Tangier disease.
20089670 2010 A2A adenosine receptor stimulation decreases foam cell formation by enhancing ABCA1-dependent cholesterol efflux.
20079340 2010 Increased expression of cholesterol transporter ABCA1 is highly correlated with severity of dementia in AD hippocampus.
20067955 2010 Carriers of loss-of-function mutations in ABCA1 display pancreatic beta-cell dysfunction.
20064972 2010 Oxidation of apolipoprotein A-I by myeloperoxidase impairs the initial interactions with ABCA1 required for signaling and cholesterol export.
20057170 2010 TGF-beta1 up-regulates expression of ABCA1, ABCG1 and SR-BI through liver X receptor alpha signaling pathway in THP-1 macrophage-derived foam cells.
20031551 2008 Pharmacogenetic predictors of statin-mediated low-density lipoprotein cholesterol reduction and dose response.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902402 2010 Expression of the lipid transporters ABCA3 and ABCA1 is diminished in human breast cancer tissue.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19837407 2010 Impact of android overweight or obesity and insulin resistance on basal and postprandial SR-BI and ABCA1-mediated serum cholesterol efflux capacities.
19828131 2010 HIF-1beta determines ABCA1 expression under hypoxia in human macrophages.
19783654 2009 The macrophage cholesterol exporter ABCA1 functions as an anti-inflammatory receptor.
19773416 2010 A gene score of nine LDL and HDL regulating genes is associated with fluvastatin-induced cholesterol changes in women.
19767535 2010 Apolipoprotein M expression increases the size of nascent pre beta HDL formed by ATP binding cassette transporter A1.
19765707 2010 Tangier disease caused by compound heterozygosity for ABCA1 mutations R282X and Y1532C.
19743957 2009 Novel rare alleles of ABCA1 are exclusively associated with extreme high-density lipoprotein-cholesterol levels among the Han Chinese.
19721717 2009 Apoptotic engulfment pathway and schizophrenia.
19692220 2010 The effects of ABCG5/G8 polymorphisms on HDL-cholesterol concentrations depend on ABCA1 genetic variants in the Boston Puerto Rican Health Study.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19673941 2009 Effect of R219K polymorphism of the ABCA1 gene on the lipid-lowering effect of pravastatin in Chinese patients with coronary heart disease.
19656776 2009 DNA methylation differences after exposure to prenatal famine are common and timing- and sex-specific.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19606474 2009 A survey of ABCA1 sequence variation confirms association with dementia.
19596329 2010 Genetic variation in the ABCA1 gene, HDL cholesterol, and risk of ischemic heart disease in the general population.
19589783 2009 Cyclosporin A decreases apolipoprotein E secretion from human macrophages via a protein phosphatase 2B-dependent and ATP-binding cassette transporter A1 (ABCA1)-independent pathway.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19556721 2009 Impaired insulin secretion in four Tangier disease patients with ABCA1 mutations.
19556522 2009 Palmitoylation of ATP-binding cassette transporter A1 is essential for its trafficking and function.
19553242 2009 Identification of a novel human cellular HDL biosynthesis defect.
19538231 2009 Effect of ABCA1 variant on atherogenic dyslipidaemia in patients with Type 2 diabetes treated with rosiglitazone.
19530967 2009 ABCA1 expression and statins: inhibitory effect in peripheral blood mononuclear cells.
19528336 2009 ATP-binding cassette transporter A1 expression and apolipoprotein A-I binding are impaired in intima-type arterial smooth muscle cells.
19489872 2010 Association of polymorphisms in genes involved in lipoprotein metabolism with plasma concentrations of remnant lipoproteins and HDL subpopulations before and after hormone therapy in postmenopausal women.
19474452 2009 Perioperative genomic profiles using structure-specific oligonucleotide probes.
19446537 2009 Interaction between HMGCR and ABCA1 cholesterol-related genes modulates Alzheimer's disease risk.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19341173 Is dyslipidemia sustained during remission of nephrotic syndrome genetically determined? Evaluation of genetic polymorphisms of proteins involved in lipoprotein metabolism in children and adolescents with nephrotic syndrome.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19304576 2009 Rab8 regulates ABCA1 cell surface expression and facilitates cholesterol efflux in primary human macrophages.
19304534 2009 [Association of ATP-binding cassette transporter A1 R219K polymorphism with atrial fibrillation].
19295162 2009 Specific loss of brain ABCA1 increases brain cholesterol uptake and influences neuronal structure and function.
19287193 2009 High glucose, unsaturated and saturated fatty acids differentially regulate expression of ATP-binding cassette transporters ABCA1 and ABCG1 in human macrophages.
19285487 2009 Genetic determinants of plasma HDL-cholesterol levels in prepubertal children.
19268428 2009 The COP9 signalosome controls ubiquitinylation of ABCA1.
19261092 2009 Expression of liver X receptor alpha and lipid metabolism in granulocyte-macrophage colony-stimulating factor-induced human monocyte-derived macrophage.
19258317 2009 Formation of two intramolecular disulfide bonds is necessary for ApoA-I-dependent cholesterol efflux mediated by ABCA1.
19202195 2009 Sodium taurocholate-dependent lipid efflux by ABCA1: effects of W590S mutation on lipid translocation and apolipoprotein A-I dissociation.
19201688 2009 Tissue-specific roles of ABCA1 influence susceptibility to atherosclerosis.
19201410 2009 On the mechanism for PPAR agonists to enhance ABCA1 gene expression.
19170766 2009 Retroendocytosis pathway of ABCA1/apoA-I contributes to HDL formation.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19168441 2009 Human endothelial cells of the placental barrier efficiently deliver cholesterol to the fetal circulation via ABCA1 and ABCG1.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19151332 2009 Functional implications of the influence of ABCA1 on lipid microenvironment at the plasma membrane: a biophysical study.
19148283 2009 Genetic differences between the determinants of lipid profile phenotypes in African and European Americans: the Jackson Heart Study.
19133158 2009 Multiple splice defects in ABCA1 cause low HDL-C in a family with hypoalphalipoproteinemia and premature coronary disease.
19131637 2009 Associations of genetic variants in ATP-binding cassette A1 and cholesteryl ester transfer protein and differences in lipoprotein subclasses in the multi-ethnic study of atherosclerosis.
19099922 2008 [Geographical characteristics of single nucleotide polymorphism of candidate genes associated with coronary artery disease in Chinese Han population].
19070858 2009 Eicosapentaenoic acid reduces ABCA1 serine phosphorylation and impairs ABCA1-dependent cholesterol efflux through cyclic AMP/protein kinase A signaling pathway in THP-1 macrophage-derived foam cells.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19059534 2009 Relationships between common polymorphisms of adenosine triphosphate-binding cassette transporter A1 and high-density lipoprotein cholesterol and coronary heart disease in a population with type 2 diabetes mellitus.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19019193 2009 Severe HDL deficiency due to novel defects in the ABCA1 transporter.
18996286 2008 Common variants in the ATP-binding cassette transporter 1 gene with decreased HDL-cholesterol levels and coronary artery disease.
18955690 2008 Severe Tangier disease with a novel ABCA1 gene mutation.
18927546 2008 Lp(a) and risk of recurrent cardiac events in obese postinfarction patients.
18927311 2008 IL12RB2 and ABCA1 genes are associated with susceptibility to radiation dermatitis.
18841006 2008 Novel mutation in the ABCA1 gene identified in a chinese patient with dementia and atherothrombotic cerebral infarction.
18820007 2008 LXR-induced reverse cholesterol transport in human airway smooth muscle is mediated exclusively by ABCA1.
18805791 2008 Asymmetry in the lipid affinity of bihelical amphipathic peptides. A structural determinant for the specificity of ABCA1-dependent cholesterol efflux by peptides.
18803945 2008 The influence of two variants in the adenosine triphosphate-binding cassette transporter 1 gene on plasma lipids and carotid atherosclerosis.
18789440 2009 IFN-gamma down-regulates ABCA1 expression by inhibiting LXRalpha in a JAK/STAT signaling pathway-dependent manner.
18782758 2008 Direct interaction of nuclear liver X receptor-beta with ABCA1 modulates cholesterol efflux.
18782226 2008 Formation of cholesterol-enriched structures by aberrant intracellular accumulation of ATP-binding cassette transporter A1.
18776170 2009 ABCA1 mutants reveal an interdependency between lipid export function, apoA-I binding activity, and Janus kinase 2 activation.
18767813 2008 ABCA1 promotes the de novo biogenesis of apolipoprotein CIII-containing HDL particles in vivo and modulates the severity of apolipoprotein CIII-induced hypertriglyceridemia.
18762171 2008 Induction of ABCA1 by overexpression of hormone-sensitive lipase in macrophages.
18711208 2008 Origins of intestinal ABCA1-mediated HDL-cholesterol.
18706283 2008 Effect of ABCA1 mutations on risk for myocardial infarction.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18640393 2008 Determinants of leukocyte adenosine triphosphate-binding cassette transporter G1 gene expression in type 2 diabetes mellitus.
18621447 2010 The R219K polymorphism in the ATP-binding cassette transporter 1 gene has a protective effect on atherothrombotic cerebral infarction in Chinese Han ethnic population.
18617649 2008 ApoA-I facilitates ABCA1 recycle/accumulation to cell surface by inhibiting its intracellular degradation and increases HDL generation.
18583707 2008 Initial interaction of apoA-I with ABCA1 impacts in vivo metabolic fate of nascent HDL.
18566305 2008 Genetic factors for ischemic and hemorrhagic stroke in Japanese individuals.
18523221 2008 Association of loss-of-function mutations in the ABCA1 gene with high-density lipoprotein cholesterol levels and risk of ischemic heart disease.
18490524 2008 Reduced expression of ATP-binding cassette transporter G1 increases cholesterol accumulation in macrophages of patients with type 2 diabetes mellitus.
18484747 2008 SPTLC1 binds ABCA1 to negatively regulate trafficking and cholesterol efflux activity of the transporter.
18468402 Investigation of ABCA1 C69T and G-191C polymorphisms in coronary artery disease.
18385134 2008 ATP-binding cassette A1-mediated lipidation of apolipoprotein A-I occurs at the plasma membrane and not in the endocytic compartments.
18354102 2008 Polymorphisms associated with cholesterol and risk of cardiovascular events.
18343215 2008 The ABCA1 Q597R mutant undergoes trafficking from the ER upon ER stress.
18287097 2008 An amphipathic helical region of the N-terminal barrel of phospholipid transfer protein is critical for ABCA1-dependent cholesterol efflux.
18252847 2008 Characterization and properties of pre beta-HDL particles formed by ABCA1-mediated cellular lipid efflux to apoA-I.
18239666 2008 Association of common JAK2 variants with body fat, insulin sensitivity and lipid profile.
18220685 2007 The ATP-binding cassette transporter subfamily A member 1 (ABC-A1) and type 2 diabetes: an association beyond HDL cholesterol.
18219093 2008 Protective effect of R allele of PON1 gene on the coronary artery disease in the presence of specific genetic background.
18218626 2008 Quantitative analysis of ABCA1-dependent compartmentalization and trafficking of apolipoprotein A-I: implications for determining cellular kinetics of nascent high density lipoprotein biogenesis.
18215356 2008 Effects of ABCA1 variants on rosiglitazone monotherapy in newly diagnosed type 2 diabetes patients.
18199144 2008 Novel rare mutations and promoter haplotypes in ABCA1 contribute to low-HDL-C levels.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
18164264 2008 Effects of ABCA1 SNPs, including the C-105T novel variant, on serum lipids of Brazilian individuals.
18097620 2008 Association of polymorphisms of ABCA1 and ROS1 with hypertension in Japanese individuals.
18057374 2008 Cellular SR-BI and ABCA1-mediated cholesterol efflux are gender-specific in healthy subjects.
18003760 2008 Association of the ATP-binding cassette transporter A1 R230C variant with early-onset type 2 diabetes in a Mexican population.
17992631 2007 Human aldehyde oxidase 1 interacts with ATP-binding cassette transporter-1 and modulates its activity in hepatocytes.
17991739 2008 OSBP-related protein 8 (ORP8) suppresses ABCA1 expression and cholesterol efflux from macrophages.
17951323 2008 Genetic variation in ABCA1 predicts ischemic heart disease in the general population.
17923263 2007 R219K polymorphism of ATP binding cassette transporter A1 related with low HDL in overweight/obese Thai males.
17855807 2007 Maternal and fetal variation in genes of cholesterol metabolism is associated with preterm delivery.
17710129 2007 Transbilayer phospholipid movements in ABCA1-deficient cells.
17700364 2007 Contribution of 20 single nucleotide polymorphisms of 13 genes to dyslipidemia associated with antiretroviral therapy.
17690481 2007 Cholesterol and plant sterol efflux from cultured intestinal epithelial cells is mediated by ATP-binding cassette transporters.
17689273 2007 Interleukin-10 inhibits the down-regulation of ATP binding cassette transporter A1 by tumour necrosis factor-alpha in THP-1 macrophage-derived foam cells.
17656736 2007 Identification of an ABCA1-dependent phospholipid-rich plasma membrane apolipoprotein A-I binding site for nascent HDL formation: implications for current models of HDL biogenesis.
17608096 2007 Synergistic effect between polymorphisms of PPARA and ABCA1 genes on the premature coronary artery disease.
17604270 2007 Mechanism of ATP-binding cassette transporter A1-mediated cellular lipid efflux to apolipoprotein A-I and formation of high density lipoprotein particles.
17556657 2007 ATP-binding cassette transporter A1 gene transcription is downregulated by activator protein 2alpha. Doxazosin inhibits activator protein 2alpha and increases high-density lipoprotein biogenesis independent of alpha1-adrenoceptor blockade.
17553166 2007 The effect of ABCA1 gene polymorphisms on ischaemic stroke risk and relationship with lipid profile.
17550732 2007 [Correlation of cholesterol 24-hydroxylase and ATP-binding cassette transporter A1 polymorphisms with Alzheimer's disease].
17521614 2007 Adiponectin accelerates reverse cholesterol transport by increasing high density lipoprotein assembly in the liver.
17510949 2007 A novel intronic polymorphism of ABCA1 gene reveals risk for sporadic Alzheimer's disease in Chinese.
17510946 2007 Association of genetic variants of ABCA1 with Alzheimer's disease risk.
17510466 2007 Minimal lipidation of pre-beta HDL by ABCA1 results in reduced ability to interact with ABCA1.
17481640 2008 ABCA1 expression in humans is associated with physical activity and alcohol consumption.
17430597 2007 Apolipoprotein E levels in cerebrospinal fluid and the effects of ABCA1 polymorphisms.
17412755 2007 Functional polymorphism in ABCA1 influences age of symptom onset in coronary artery disease patients.
17407076 2007 [Analysis of ATP binding cassette A1 gene R219K polymorphism in patients with endogenous hypertriglyceridemia in Chinese population].
17383594 2007 Genotypic variation in ATP-binding cassette transporter-1 (ABCA1) as contributors to the high and low high-density lipoprotein-cholesterol (HDL-C) phenotype.
17372331 2007 Common ABCA1 variants, HDL levels, and cellular cholesterol efflux in subjects with familial low HDL.
17368464 2007 Common genetic variation in the ATP-binding cassette transporter A1, plasma lipids, and risk of coronary heart disease.
17335784 2007 Polymorphisms of cholesterol metabolism genes CYP46 and ABCA1 and the risk of sporadic Alzheimer's disease in Chinese.
17324514 2007 ABCA1 polymorphisms and Alzheimer's disease.
17305370 2007 The C-terminal lipid-binding domain of apolipoprotein E is a highly efficient mediator of ABCA1-dependent cholesterol efflux that promotes the assembly of high-density lipoproteins.
17287470 2007 The ATP-binding cassette transporter A1 R230C variant affects HDL cholesterol levels and BMI in the Mexican population: association with obesity and obesity-related comorbidities.
17268197 2007 ATP-binding cassette transporter A1 gene I823M polymorphism affects plasma high-density lipoprotein cholesterol level and modifies the effect of low high-density lipoprotein cholesterol on the risk of coronary artery disease.
17241464 2007 ABCA1, ABCG1 and SR-BI: hormonal regulation in primary rat hepatocytes and human cell lines.
17205124 2006 Cooperation between engulfment receptors: the case of ABCA1 and MEGF10.
17196163 2007 Angiotensin II increases the cholesterol content of foam cells via down-regulating the expression of ATP-binding cassette transporter A1.
17135600 2006 ABCA1 single nucleotide polymorphisms on high-density lipoprotein-cholesterol and overweight: the D.E.S.I.R. study.
17135302 2007 ROS and NF-kappaB but not LXR mediate IL-1beta signaling for the downregulation of ATP-binding cassette transporter A1.
17121837 2007 Role of ABCG1 and ABCA1 in regulation of neuronal cholesterol efflux to apolipoprotein E discs and suppression of amyloid-beta peptide generation.
17113061 2007 Do mutations causing low HDL-C promote increased carotid intima-media thickness?
17082211 2007 Uraemic plasma decreases the expression of ABCA1, ABCG1 and cell-cycle genes in human coronary arterial endothelial cells.
17070530 2007 Common coding polymorphisms in the ABCA1 gene and risk of early-onset coronary heart disease in northern Germany.
17020879 2006 Correction of apolipoprotein A-I-mediated lipid efflux and high density lipoprotein particle formation in human Niemann-Pick type C disease fibroblasts.
17001213 2006 Relationship of classical and non-classical risk factors with genetic variants relevant to coronary heart disease.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16928680 2006 ABCA1 overexpression in the liver of LDLr-KO mice leads to accumulation of pro-atherogenic lipoproteins and enhanced atherosclerosis.
16902247 2006 ABCA1 and ABCG1 or ABCG4 act sequentially to remove cellular cholesterol and generate cholesterol-rich HDL.
16901265 2006 SREBP-2 positively regulates transcription of the cholesterol efflux gene, ABCA1, by generating oxysterol ligands for LXR.
16879828 2007 Associations between two common polymorphisms in the ABCA1 gene and subclinical atherosclerosis: Multi-Ethnic Study of Atherosclerosis (MESA).
16873719 2006 Specific mutations in ABCA1 have discrete effects on ABCA1 function and lipid phenotypes both in vivo and in vitro.
16870193 2007 Sustained elevations in NEFA induce cyclooxygenase-2 activity and potentiate THP-1 macrophage foam cell formation.
16855366 2006 Molecular defects in the ABCA1 pathway affect platelet function.
16825673 2006 Regulation of ABCA1 expression in human keratinocytes and murine epidermis.
16806540 2007 A novel haplotype in ABCA1 gene effects plasma HDL-C concentration.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16770077 2006 Concordant association of lipid gene variation with a combined HDL/LDL-cholesterol phenotype in two European populations.
16763159 2006 Consistent effects of genes involved in reverse cholesterol transport on plasma lipid and apolipoprotein levels in CARDIA participants.
16730733 2007 Unsaturated fatty acids suppress the expression of the ATP-binding cassette transporter G1 (ABCG1) and ABCA1 genes via an LXR/RXR responsive element.
16725228 2007 Gender-specific association of ATP-binding cassette transporter 1 (ABCA1) polymorphisms with the risk of late-onset Alzheimer's disease.
16709568 2006 Transition from dimers to higher oligomeric forms occurs during the ATPase cycle of the ABCA1 transporter.
16702602 2006 Efflux of sphingomyelin, cholesterol, and phosphatidylcholine by ABCG1.
16596262 2006 Polymorphism in ABCA1 influences CSF 24S-hydroxycholesterol levels but is not a major risk factor of Alzheimer's disease.
16542392 2006 Common variants of multiple genes that control reverse cholesterol transport together explain only a minor part of the variation of HDL cholesterol levels.
16505586 2006 ABCA1 and biogenesis of HDL.
16500904 2006 Purification and ATPase activity of human ABCA1.
16497665 2006 Myeloperoxidase impairs ABCA1-dependent cholesterol efflux through methionine oxidation and site-specific tyrosine chlorination of apolipoprotein A-I.
16456089 2006 Macrophage ATP-binding cassette transporter A1 overexpression inhibits atherosclerotic lesion progression in low-density lipoprotein receptor knockout mice.
16446539 2006 Decreased frequencies of ABCA1 polymorphisms R219K and V771M in Hungarian patients with cerebrovascular and cardiovascular diseases.
16443932 2006 Apolipoprotein A-I activates Cdc42 signaling through the ABCA1 transporter.
16429166 2005 Accurate prediction of the functional significance of single nucleotide polymorphisms and mutations in the ABCA1 gene.
16418537 2006 Characterization of nascent HDL particles and microparticles formed by ABCA1-mediated efflux of cellular lipids to apoA-I.
16410457 2006 Relative contributions of ABCA1 and SR-BI to cholesterol efflux to serum from fibroblasts and macrophages.
16343503 2006 Functional mutations of the ABCA1 gene in subjects of French-Canadian descent with HDL deficiency.
16313984 2006 ABCA1 polymorphisms and prognosis after myocardial infarction in young patients.
16254209 2006 Glucocorticoid receptor regulates ATP-binding cassette transporter-A1 expression and apolipoprotein-mediated cholesterol efflux from macrophages.
16235041 2005 Tangier disease: still more questions than answers.
16226177 2005 Mutation in ABCA1 predicted risk of ischemic heart disease in the Copenhagen City Heart Study Population.
16207713 2005 Lack of ABCA1 considerably decreases brain ApoE level and increases amyloid deposition in APP23 mice.
16192292 2006 The potential role of human endogenous retrovirus K10 in the pathogenesis of rheumatoid arthritis: a preliminary study.
16192291 2006 Ultrasonography for rheumatologists: the development of specific competency based educational outcomes.
16192290 2006 Prospective 7 year follow up imaging study comparing radiography, ultrasonography, and magnetic resonance imaging in rheumatoid arthritis finger joints.
16192289 2006 Synovial Chlamydia trachomatis up regulates expression of a panel of genes similar to that transcribed by Mycobacterium tuberculosis during persistent infection.
16192288 2005 A splice form of polycystin-2, lacking exon 7, does not interact with polycystin-1.
16192287 2005 No widespread induction of cell death genes occurs in pure motoneurons in an amyotrophic lateral sclerosis mouse model.
16192286 2005 How do elderly patients decide where to go for major surgery? Telephone interview survey.
16192285 2005 Ionic mechanism of mechano-perception in Characeae.
16192284 2005 Yeast kinetochore microtubule dynamics analyzed by high-resolution three-dimensional microscopy.
16192283 2005 Single molecule recognition between cytochrome C 551 and gold-immobilized azurin by force spectroscopy.
16192282 2005 Titration behavior of residues at the entrance of the D-pathway of cytochrome c oxidase from paracoccus denitrificans investigated by continuum electrostatic calculations.
16192281 2005 A quantitative model of the switch cycle of an archaeal flagellar motor and its sensory control.
16192279 2005 The crystal structure of mitochondrial (Type 1A) peptide deformylase provides clear guidelines for the design of inhibitors specific for the bacterial forms.
16192278 2005 Functional comparison between secretory pathway Ca2+/Mn2+-ATPase (SPCA) 1 and sarcoplasmic reticulum Ca2+-ATPase (SERCA) 1 isoforms by steady-state and transient kinetic analyses.
16192277 2005 MJ0917 in archaeon Methanococcus jannaschii is a novel NADP phosphatase/NAD kinase.
16192276 2005 Disruption of the phosphatidylserine decarboxylase gene in mice causes embryonic lethality and mitochondrial defects.
16192275 2005 The type III inositol 1,4,5-trisphosphate receptor preferentially transmits apoptotic Ca2+ signals into mitochondria.
16192274 2005 Crystal structures of Delta1-piperideine-2-carboxylate/Delta1-pyrroline-2-carboxylate reductase belonging to a new family of NAD(P)H-dependent oxidoreductases: conformational change, substrate recognition, and stereochemistry of the reaction.
16192273 2005 Structure of the unphosphorylated STAT5a dimer.
16192272 2005 Solution structures and backbone dynamics of arsenate reductase from Bacillus subtilis: reversible conformational switch associated with arsenate reduction.
16192271 2005 HDAC6 and microtubules are required for autophagic degradation of aggregated huntingtin.
16192270 2005 A novel Arabidopsis gene causes Bax-like lethality in Saccharomyces cerevisiae.
16192269 2005 Purification of ATP-binding cassette transporter A1 and associated binding proteins reveals the importance of beta1-syntrophin in cholesterol efflux.
16166555 2005 Cardioprotective role of the mitochondrial ATP-binding cassette protein 1.
16157450 2006 Association studies of cholesterol metabolism genes (CH25H, ABCA1 and CH24H) in Alzheimer's disease.
16126721 2005 Acrolein impairs ATP binding cassette transporter A1-dependent cholesterol export from cells through site-specific modification of apolipoprotein A-I.
16120575 2005 [Relationship between the R219K polymorphism of ATP-binding cassette transporter 1 gene and coronary heart disease].
16118212 2005 Unsaturated fatty acids phosphorylate and destabilize ABCA1 through a phospholipase D2 pathway.
16086925 2005 Candidate gene susceptibility variants predict intermediate end points but not angiographic coronary artery disease.
16080812 2005 [Study on the association of ABCA1 gene common variants with the risk of coronary atherosclerotic heart disease].
16055210 2006 R1615P: a novel mutation in ABCA1 associated with low levels of HDL and type II diabetes mellitus.
16030523 2005 Genetic determinants of plasma HDL-cholesterol levels in familial hypercholesterolemia.
16009332 2005 ABCA1, ApoA-I and type II DM.
15983222 2005 Advanced glycation end product precursors impair ABCA1-dependent cholesterol removal from cells.
15961705 2005 Genes of cholesterol metabolism in human atheroma: overexpression of perilipin and genes promoting cholesterol storage and repression of ABCA1 expression.
15958302 2005 [Significance of -191G/C single nucleotide polymorphisms in the promoter region of ATP-binding cassette transporter gene in coronary artery disease].
15952113 2005 Effect of the interaction between paranoxonase 1 and ATP-binding cassette transporter 1 gene polymorphism on serum lipid level.
15951431 2005 A PEST deletion mutant of ABCA1 shows impaired internalization and defective cholesterol efflux from late endosomes.
15935359 2005 Common polymorphisms of ATP binding cassette transporter A1, including a functional promoter polymorphism, associated with plasma high density lipoprotein cholesterol levels in Turks.
15930518 2005 Heterogeneity of high density lipoprotein generated by ABCA1 and ABCA7.
15905177 2005 Headgroup-specific exposure of phospholipids in ABCA1-expressing cells.
15890646 2005 Glycosphingolipid accumulation inhibits cholesterol efflux via the ABCA1/apolipoprotein A-I pathway: 1-phenyl-2-decanoylamino-3-morpholino-1-propanol is a novel cholesterol efflux accelerator.
15851589 2005 Reduced ABCA1-mediated cholesterol efflux and accelerated atherosclerosis in apolipoprotein E-deficient mice lacking macrophage-derived ACAT1.
15829498 2005 Toll-like receptor 4 variant D299G is associated with susceptibility to age-related macular degeneration.
15817453 2005 Regulation of macrophage cholesterol efflux through hydroxymethylglutaryl-CoA reductase inhibition: a role for RhoA in ABCA1-mediated cholesterol efflux.
15790791 2005 A novel missense mutation in ABCA1 results in altered protein trafficking and reduced phosphatidylserine translocation in a patient with Scott syndrome.
15774904 2005 Activation of ATP-binding cassette transporter A1 transcription by chromatin remodeling complex.
15722566 2005 Denaturing high-performance liquid chromatography in the detection of ABCA1 gene mutations in familial HDL deficiency.
15721294 2005 Association of the ABCA1 gene polymorphisms with type 2 DM in a Japanese population.
15696473 2005 [Single nucleotide polymorphisms of genes associated with high density lipoprotein metabolism in Chinese population].
15657615 2005 Polymorphisms in APOA1 and LPL genes are statistically independently associated with fasting TG in men with CAD.
15649702 2005 ABCA2 is a strong genetic risk factor for early-onset Alzheimer's disease.
15574409 2005 Tyrosine 192 in apolipoprotein A-I is the major site of nitration and chlorination by myeloperoxidase, but only chlorination markedly impairs ABCA1-dependent cholesterol transport.
15528481 2005 Genotypic effect of the -565C>T polymorphism in the ABCA1 gene promoter on ABCA1 expression and severity of atherosclerosis.
15528463 2004 ABCA1 expression in carotid atherosclerotic plaques.
15520867 2004 Genetic variation in ABC transporter A1 contributes to HDL cholesterol in the general population.
15500734 2004 [Relationship between ATP-binding cassette transporter 1 R219K genetic variation and blood lipids].
15492319 2004 Cellular physiology of cholesterol efflux in vascular endothelial cells.
15469992 2004 Association of ABCA1 with syntaxin 13 and flotillin-1 and enhanced phagocytosis in tangier cells.
15358760 2004 Sterol-responsive element-binding protein (SREBP) 2 down-regulates ATP-binding cassette transporter A1 in vascular endothelial cells: a novel role of SREBP in regulating cholesterol metabolism.
15358117 2004 Serum amyloid A promotes ABCA1-dependent and ABCA1-independent lipid efflux from cells.
15340333 2004 [Allele Frequency Analysis of Four Single Nucleotide Polymorphisms Locating in Promoter and 5'-Untranslated Regions of ABCAI Gene in Young Men - Survivors From Myocardial Infarction].
15297675 2004 Multiple rare alleles contribute to low plasma levels of HDL cholesterol.
15292375 2004 Intracellular cholesterol mobilization involved in the ABCA1/apolipoprotein-mediated assembly of high density lipoprotein in fibroblasts.
15288432 2004 Association of ABCA1 with late-onset Alzheimer's disease is not observed in a case-control study.
15280376 2004 Characterization of oligomeric human ATP binding cassette transporter A1. Potential implications for determining the structure of nascent high density lipoprotein particles.
15262183 2004 Screening for functional sequence variations and mutations in ABCA1.
15218032 2004 Phosphorylation by protein kinase CK2 modulates the activity of the ATP binding cassette A1 transporter.
15201080 2004 [Distribution of -477C/T single nucleotide polymorphism in the promoter region of ABCA1 gene and its significance for plasma lipids levels in normal Chinese Han population].
15164053 2004 DNA sequence and analysis of human chromosome 9.
15163665 2004 Impaired platelet activation in familial high density lipoprotein deficiency (Tangier disease).
15158913 2004 Two novel missense mutations in ABCA1 result in altered trafficking and cause severe autosomal recessive HDL deficiency.
15140889 2004 Probucol inactivates ABCA1 in the plasma membrane with respect to its mediation of apolipoprotein binding and high density lipoprotein assembly and to its proteolytic degradation.
15135251 2004 Genetic polymorphisms affecting the phenotypic expression of familial hypercholesterolemia.
15102890 2004 Cross-inhibition of SR-BI- and ABCA1-mediated cholesterol transport by the small molecules BLT-4 and glyburide.
15066991 2004 Apolipoprotein A-I-stimulated apolipoprotein E secretion from human macrophages is independent of cholesterol efflux.
15033469 2004 Statins downregulate ATP-binding-cassette transporter A1 gene expression in macrophages.
15024730 2004 Genetic variants of ABCA1 modify Alzheimer disease risk and quantitative traits related to beta-amyloid metabolism.
15019541 2004 Familial HDL deficiency due to ABCA1 gene mutations with or without other genetic lipoprotein disorders.
14993242 2004 LXR/RXR ligand activation enhances basolateral efflux of beta-sitosterol in CaCo-2 cells.
14986172 2004 A promoter variant of the ATP-binding cassette transporter A1 gene alters the HDL cholesterol level in the general Japanese population.
14967823 2004 LXR-mediated activation of macrophage stearoyl-CoA desaturase generates unsaturated fatty acids that destabilize ABCA1.
14967052 2004 Cross-linking and lipid efflux properties of apoA-I mutants suggest direct association between apoA-I helices and ABCA1.
14962947 2004 In-depth haplotype analysis of ABCA1 gene polymorphisms in relation to plasma ApoA1 levels and myocardial infarction.
14767869 2004 Associations between serum high-density lipoprotein cholesterol or apolipoprotein AI levels and common genetic variants of the ABCA1 gene in Japanese school-aged children.
14754908 2004 Molecular interactions between apoE and ABCA1: impact on apoE lipidation.
14747463 2004 The ABCA1 transporter modulates late endocytic trafficking: insights from the correction of the genetic defect in Tangier disease.
14734645 2004 Apolipoprotein A-1 interaction with plasma membrane lipid rafts controls cholesterol export from macrophages.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701850 2004 Phosphorylation and stabilization of ATP binding cassette transporter A1 by synthetic amphiphilic helical peptides.
14701824 2004 Apolipoprotein A-I activates cellular cAMP signaling through the ABCA1 transporter.
14701812 2004 Depletion of pre-beta-high density lipoprotein by human chymase impairs ATP-binding cassette transporter A1- but not scavenger receptor class B type I-mediated lipid efflux to high density lipoprotein.
14681836 2004 Leukocyte ABCA1 gene expression is associated with fasting glucose concentration in normoglycemic men.
14668333 2004 Janus kinase 2 modulates the apolipoprotein interactions with ABCA1 required for removing cellular cholesterol.
14660648 2004 Molecular and cellular physiology of apolipoprotein A-I lipidation by the ATP-binding cassette transporter A1 (ABCA1).
14644402 2003 Heterozygosity for ABCA1 gene mutations: effects on enzymes, apolipoproteins and lipoprotein particle size.
14576201 2003 Novel polypyrimidine variation (IVS46: del T -39...-46) in ABCA1 causes exon skipping and contributes to HDL cholesterol deficiency in a family with premature coronary disease.
14570867 2004 Human ABCA7 supports apolipoprotein-mediated release of cellular cholesterol and phospholipid to generate high density lipoprotein.
14560020 2003 Retinoic acid receptor-mediated induction of ABCA1 in macrophages.
14559902 2003 Phospholipid transfer protein interacts with and stabilizes ATP-binding cassette transporter A1 and enhances cholesterol efflux from cells.
12966036 2003 Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors.
12952980 2003 Apolipoprotein A-I activates protein kinase C alpha signaling to phosphorylate and stabilize ATP binding cassette transporter A1 for the high density lipoprotein assembly.
12928428 2003 Effects of apolipoprotein A-I on ATP-binding cassette transporter A1-mediated efflux of macrophage phospholipid and cholesterol: formation of nascent high density lipoprotein particles.
12870173 2003 R219K polymorphism of the ABCA1 gene and its modulation of the variations in serum high-density lipoprotein cholesterol and triglycerides related to age and adiposity in white versus black young adults. The Bogalusa heart study.
12869555 2003 Phosphorylation of a pest sequence in ABCA1 promotes calpain degradation and is reversed by ApoA-I.
12860256 2003 A common Ile 823 Met variant of ATP-binding cassette transporter A1 gene (ABCA1) alters high density lipoprotein cholesterol level in Japanese population.
12813037 2003 Impaired ABCA1-dependent lipid efflux and hypoalphalipoproteinemia in human Niemann-Pick type C disease.
12804586 2003 Dynamic regulation of alternative ATP-binding cassette transporter A1 transcripts.
12763760 2003 Efflux and atherosclerosis: the clinical and biochemical impact of variations in the ABCA1 gene.
12730295 2003 Alterations of plasma lipids in mice via adenoviral-mediated hepatic overexpression of human ABCA1.
12709788 2003 ABCA1 gene polymorphisms and their associations with coronary artery disease and plasma lipids in males from three ethnic populations in Singapore.
12706378 2003 Expression, regulation, and activity of ABCA1 in human cell lines.
12700893 2003 The association of the R219K polymorphism in the ATP-binding cassette transporter 1 ( ABCA1) gene with coronary heart disease and hyperlipidaemia.
12624133 2003 A common variant in the ABCA1 gene is associated with a lower risk for premature coronary heart disease in familial hypercholesterolaemia.
12615681 2003 Study of ABCA1 function in transgenic mice.
12600975 2003 Absence of ABCA1 mutations in individuals with low serum HDL-cholesterol.
12600718 ABCA1 modulates CSF cholesterol levels and influences the age at onset of Alzheimer's disease.
12576507 2003 Abnormal splicing of ABCA1 pre-mRNA in Tangier disease due to a IVS2 +5G>C mutation in ABCA1 gene.
12562845 2003 Synthetic amphipathic helical peptides promote lipid efflux from cells by an ABCA1-dependent and an ABCA1-independent pathway.
12551894 2003 Secretory vesicular transport from the Golgi is altered during ATP-binding cassette protein A1 (ABCA1)-mediated cholesterol efflux.
12535741 2003 ATP-binding cassette transporter A1 locus is not a major determinant of HDL-C levels in a population at high risk for coronary heart disease.
12511593 2003 A PEST sequence in ABCA1 regulates degradation by calpain protease and stabilization of ABCA1 by apoA-I.
12509412 2003 Effects of mutations of ABCA1 in the first extracellular domain on subcellular trafficking and ATP binding/hydrolysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426219 2002 ATP-binding cassette transporter 1 participates in LDL oxidation by artery wall cells.
12407001 2002 Lack of association between increased carotid intima-media thickening and decreased HDL-cholesterol in a family with a novel ABCA1 variant, G2265T.
12359250 2002 The ABCA1 transporter functions on the basolateral surface of hepatocytes.
12235128 2002 Molecular and functional interaction of the ATP-binding cassette transporter A1 with Fas-associated death domain protein.
12226704 2002 Emerging links between initiation of translation and human diseases.
12204794 2002 ABCA1(Alabama): a novel variant associated with HDL deficiency and premature coronary artery disease.
12196520 2002 Protein kinase A site-specific phosphorylation regulates ATP-binding cassette A1 (ABCA1)-mediated phospholipid efflux.
12176027 2002 Dominant expression of ATP-binding cassette transporter-1 on basolateral surface of Caco-2 cells stimulated by LXR/RXR ligands.
12151852 2002 ATP-binding cassette transporter A1 and cholesterol trafficking.
12111381 2002 Double deletions and missense mutations in the first nucleotide-binding fold of the ATP-binding cassette transporter A1 ( ABCA1) gene in Japanese patients with Tangier disease.
12111371 2002 Clinical variant of Tangier disease in Japan: mutation of the ABCA1 gene in hypoalphalipoproteinemia with corneal lipidosis.
12093886 2002 Increased ABCA1 activity protects against atherosclerosis.
12084722 2002 Naturally occurring mutations in the largest extracellular loops of ABCA1 can disrupt its direct interaction with apolipoprotein A-I.
12054535 2002 The carboxyterminus of the ATP-binding cassette transporter A1 interacts with a beta2-syntrophin/utrophin complex.
12032171 2002 Bacterial lipopolysaccharide induces expression of ABCA1 but not ABCG1 via an LXR-independent pathway.
12009425 2002 Novel ABCA1 compound variant associated with HDL cholesterol deficiency.
11929608 2002 Apo AI/ABCA1-dependent and HDL3-mediated lipid efflux from compositionally distinct cholesterol-based microdomains.
11893753 2002 Evaluation of the role of phosphatidylserine translocase activity in ABCA1-mediated lipid efflux.
11809185 2002 Association between increased arterial-wall thickness and impairment in ABCA1-driven cholesterol efflux: an observational study.
11785958 2002 Expression and functional analyses of novel mutations of ATP-binding cassette transporter-1 in Japanese patients with high-density lipoprotein deficiency.
11752403 2002 The ATP binding cassette transporter A1 (ABCA1) modulates the development of aortic atherosclerosis in C57BL/6 and apoE-knockout mice.
11719471 2001 Rapid quantification of human ABCA1 mRNA in various cell types and tissues by real-time reverse transcription-PCR.
11476965 2001 Novel mutations in ABCA1 gene in Japanese patients with Tangier disease and familial high density lipoprotein deficiency with coronary heart disease.
11476961 2001 Homogeneous assay based on 52 primer sets to scan for mutations of the ABCA1 gene and its application in genetic analysis of a new patient with familial high-density lipoprotein deficiency syndrome.
11352567 2001 Human and mouse ABCA1 comparative sequencing and transgenesis studies revealing novel regulatory sequences.
11349008 2001 Novel polymorphisms in promoter region of atp binding cassette transporter gene and plasma lipids, severity, progression, and regression of coronary atherosclerosis and response to therapy.
11279031 2001 The zinc finger protein 202 (ZNF202) is a transcriptional repressor of ATP binding cassette transporter A1 (ABCA1) and ABCG1 gene expression and a modulator of cellular lipid efflux.
11257261 2001 Common variants in the gene encoding ATP-binding cassette transporter 1 in men with low HDL cholesterol levels and coronary heart disease.
11257260 2001 A point mutation in ABC1 gene in a patient with severe premature coronary heart disease and mild clinical phenotype of Tangier disease.
11238261 2001 Common genetic variation in ABCA1 is associated with altered lipoprotein levels and a modified risk for coronary artery disease.
11162594 2001 Apolipoprotein specificity for lipid efflux by the human ABCAI transporter.
11086027 2000 Age and residual cholesterol efflux affect HDL cholesterol levels and coronary artery disease in ABCA1 heterozygotes.
10970803 2000 Cloning, characterization and tissue distribution of the rat ATP-binding cassette (ABC) transporter ABC2/ABCA2.
10938021 2000 Common and rare ABCA1 variants affecting plasma HDL cholesterol.
10884428 2000 Complete genomic sequence of the human ABCA1 gene: analysis of the human and mouse ATP-binding cassette A promoter.
10799318 2000 Analysis of hABC1 gene 5' end: additional peptide sequence, promoter region, and four polymorphisms.
10706591 2000 Novel mutations in the gene encoding ATP-binding cassette 1 in four tangier disease kindreds.
10535983 1999 Human ATP-binding cassette transporter 1 (ABC1): genomic organization and identification of the genetic defect in the original Tangier disease kindred.
10533863 1999 Mutations in the ABC1 gene in familial HDL deficiency with defective cholesterol efflux.
10525055 1999 The Tangier disease gene product ABC1 controls the cellular apolipoprotein-mediated lipid removal pathway.
10431238 1999 Tangier disease is caused by mutations in the gene encoding ATP-binding cassette transporter 1.
10431237 1999 The gene encoding ATP-binding cassette transporter 1 is mutated in Tangier disease.
10431236 1999 Mutations in ABC1 in Tangier disease and familial high-density lipoprotein deficiency.
10092505 1999 Molecular cloning of the human ATP-binding cassette transporter 1 (hABC1): evidence for sterol-dependent regulation in macrophages.
9731541 1998 Assignment of Tangier disease to chromosome 9q31 by a graphical linkage exclusion strategy.
9006906 1997 ABC1, an ATP binding cassette transporter required for phagocytosis of apoptotic cells, generates a regulated anion flux after expression in Xenopus laevis oocytes.
8088782 1994 Cloning of two novel ABC transporters mapping on human chromosome 9.
7766993 1995 Characterization and mapping of three new mammalian ATP-binding transporter genes from an EST database.