Property Summary

NCBI Gene PubMed Count 33
PubMed Score 176.49
PubTator Score 142.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 2.400 5.6e-03
pituitary cancer 1.600 4.1e-02
psoriasis 1.200 4.4e-10

Protein-protein Interaction (1)

Gene RIF (21)

PMID Text
21778461 There is dysregulation of the AANAT/ASMT/melatonin --> melatonin receptor axis in cholangiocarcinoma, which inhibited melatonin secretion and subsequently enhanced CCA growth.
21437622 The expression of AANAT in epithelial cells of striated ducts in human submandibular glands.
20586889 The functional expression of human SNA protein was closely associated with the elevated synthesis of N-acetylserotonin and melatonin in transgenic rice plants.
20459461 Identified 17 sequence changes in AANAT gene of patients with major depression. Show evidence of the association of genetic variability in the AANAT gene with susceptibility to major depression.
20459461 Observational study of gene-disease association. (HuGE Navigator)
20377855 Observational study of gene-disease association. (HuGE Navigator)
19839995 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19184136 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18794762 AANAT polymorphisms were not associated with adolescent idiopathic scoliosis.
18794762 Observational study of gene-disease association. (HuGE Navigator)
18569588 Single nucleotide polymorphisms in the AANAT gene identified thus far cannot explain the observed interindividual differences for nocturnal melatonin profiles in the subjects investigated.
18569588 Observational study of gene-disease association. (HuGE Navigator)
17503170 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15332344 Observational study of gene-disease association. (HuGE Navigator)
15332344 Data suggest that the -263G/C single nucleotide polymorphism of arylalkylamine-N-acetyl-transferase (AA-NAT) may be an important determinant of the late/short sleep pattern.
14728993 Observational study of gene-disease association. (HuGE Navigator)
12736803 Observational study of gene-disease association. (HuGE Navigator)
12736803 There is a significant increase in AANAT allele positivity at the single nucleotide polymorphism (alanine 129--> threonine) at between patients with DSPS & controls. AA-NAT could be a susceptibility gene for DSPS.
11393533 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVLGVCPLYLDEI      1 - 70
RHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILL     71 - 140
WRYLHHLGSQPAVRRAALMCEDALVPFYERFSFHAVGPCAITVGSLTFMELHCSLRGHPFLRRNSGC       141 - 207
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21778461 2011 Melatonin exerts by an autocrine loop antiproliferative effects in cholangiocarcinoma: its synthesis is reduced favoring cholangiocarcinoma growth.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21437622 2011 Expression and cellular localizaion of melatonin-synthesizing enzymes in rat and human salivary glands.
20586889 2010 Enhanced production of melatonin by ectopic overexpression of human serotonin N-acetyltransferase plays a role in cold resistance in transgenic rice seedlings.
20459461 2010 Resequencing and association analysis of arylalkylamine N-acetyltransferase (AANAT) gene and its contribution to major depression susceptibility.
20377855 2010 Mutation screening of melatonin-related genes in patients with autism spectrum disorders.
19839995 2009 Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19184136 2009 Examination of association of genes in the serotonin system to autism.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18794762 2008 Association study of tryptophan hydroxylase 1 and arylalkylamine N-acetyltransferase polymorphisms with adolescent idiopathic scoliosis in Han Chinese.
18569588 2008 Arylalkylamine N-acetyltransferase (AANAT) genotype as a personal trait in melatonin synthesis.
18212399 2007 Role of melatonin in upper gastrointestinal tract.
17503170 2007 The G619A Aa-nat gene polymorphism does not contribute to sleep time variation in the Brazilian population.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17164235 2007 Arylalkylamine N-acetyltransferase: "the Timezyme".
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15332344 2004 Genetic variability of arylalkylamine-N-acetyl-transferase (AA-NAT) gene and human sleep/wake pattern.
14728993 2004 A naturally occurring -263G/C variant of the human AA-NAT gene and overnight melatonin production.
12736803 2003 Significant association of the arylalkylamine N-acetyltransferase ( AA-NAT) gene with delayed sleep phase syndrome.
12552951 Correlation of the genotypes for N-acetyltransferases 1 and 2 with double bladder and prostate cancers in a case-comparison study.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12039872 2002 Serotoninergic and melatoninergic systems are fully expressed in human skin.
11934439 2002 Association of DNA-protein crosslinks and breast cancer.
11427721 2001 Role of a pineal cAMP-operated arylalkylamine N-acetyltransferase/14-3-3-binding switch in melatonin synthesis.
11393533 2001 Identification of single-nucleotide polymorphisms (SNPs) of human N-acetyltransferase genes NAT1, NAT2, AANAT, ARD1 and L1CAM in the Japanese population.
11336675 2001 Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. a role for scaffolding in enzyme regulation.
11313340 2001 cAmp regulation of arylalkylamine N-acetyltransferase (AANAT, EC 2.3.1.87): a new cell line (1E7) provides evidence of intracellular AANAT activation.
9238858 1997 The melatonin rhythm-generating enzyme: molecular regulation of serotonin N-acetyltransferase in the pineal gland.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8661026 1996 The human serotonin N-acetyltransferase (EC 2.3.1.87) gene (AANAT): structure, chromosomal localization, and tissue expression.
7502081 1995 Pineal serotonin N-acetyltransferase: expression cloning and molecular analysis.
2181999 1990 Phylogenetic distribution and function of arylalkylamine N-acetyltransferase.