Property Summary

NCBI Gene PubMed Count 17
PubMed Score 30.87
PubTator Score 15.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7766 1.6e-04
Disease Target Count Z-score Confidence
Coronary Restenosis 6 3.577 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.262 1.6e-04

Gene RIF (6)

AA Sequence

MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEGNEEGWVLEPQ      1 - 70
EGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCA     71 - 140
GFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKT    141 - 210
FQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSV    211 - 280
DCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQT    281 - 350
LRHQCQHQSGIVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSG    351 - 420
DHKAKVFCVQRPDR                                                            421 - 434
//

Text Mined References (19)

PMID Year Title