Property Summary

NCBI Gene PubMed Count 29
PubMed Score 15.03
PubTator Score 16.54

Knowledge Summary

Patent (3,434)

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -3.200 1.2e-03
posterior fossa group A ependymoma -4.900 2.4e-22
oligodendroglioma -3.100 1.2e-02
psoriasis 3.800 3.3e-06
glioblastoma -4.600 3.7e-09
osteosarcoma 3.701 3.5e-10
medulloblastoma -3.000 3.5e-07
atypical teratoid / rhabdoid tumor -4.800 2.5e-12
medulloblastoma, large-cell -4.100 1.3e-07
primitive neuroectodermal tumor -2.600 4.2e-03
pancreatic ductal adenocarcinoma liver m... 1.116 2.8e-02
lung cancer -1.100 1.1e-03
Breast cancer 2.500 2.6e-02
pediatric high grade glioma -4.200 2.1e-10
pilocytic astrocytoma -4.500 7.9e-14
subependymal giant cell astrocytoma -3.365 4.1e-02
Pick disease -1.400 3.2e-02
progressive supranuclear palsy 1.300 5.4e-03
ovarian cancer 1.700 1.3e-05

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (8)

PMID Text
25852190 Two of these kinases that were classified as resistors were PX domain-containing serine/threonine kinase (PXK) and AP2-associated kinase 1 (AAK1), which promote receptor endocytosis and may enable cells to resist TRAIL-induced apoptosis
25653444 AAK1 and GAK are critical regulators of HCV entry that function in part by activating EGFR, AP2M1, and NUMB, and as the molecular targets underlying the antiviral effect of sunitinib and erlotinib, respectively.
25496667 Genome-wide shRNA screening identifies AAK1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
21464124 AAK1 increases the localization of activated Notch to Rab5-positive endocytic vesicles, while AAK1 depletion or overexpression of Numb, an inhibitor of the pathway, interferes with this localization.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19772629 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of AP2 associated kinase 1 (AAK1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17494869 These observations suggest that AAK1 functions at multiple steps of the endosomal pathway by regulating transferrin internalization and its rapid recycling back to the plasma membrane from early/sorting endosome.

AA Sequence

MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMK      1 - 70
CALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQ     71 - 140
RLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGV    141 - 210
NAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNS    211 - 280
RYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPK    281 - 350
ARLTDPIPTTETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPPQAAGSSNQPGLLASVPQPKP    351 - 420
QAPPSQPLPQTQAKQPQAPPTPQQTPSTQAQGLPAQAQATPQHQQQLFLKQQQQQQQPPPAQQQPAGTFY    421 - 490
QQQQAQTQQFQAVHPATQKPAIAQFPVVSQGGSQQQLMQNFYQQQQQQQQQQQQQQLATALHQQQLMTQQ    491 - 560
AALQQKPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPVRQQPKVQTTPPPAVQGQKVGSLTPPSSPKTQRA    561 - 630
GHRRILSDVTHSAVFGVPASKSTQLLQAAAAEASLNKSKSATTTPSGSPRTSQQNVYNPSEGSTWNPFDD    631 - 700
DNFSKLTAEELLNKDFAKLGEGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGL    701 - 770
PLLSVSDPFIPLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIEKADVAVESLIPGLEPPV    771 - 840
PQRLPSQTESVTSNRTDSLTGEDSLLDCSLLSNPTTDLLEEFAPTAISAPVHKAAEDSNLISGFDVPEGS    841 - 910
DKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARSLLLVDQLIDL                       911 - 961
//

Text Mined References (44)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25653444 2015 AP-2-associated protein kinase 1 and cyclin G-associated kinase regulate hepatitis C virus entry and are potential drug targets.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22645275 2012 Identification of novel ATP13A2 interactors and their role in ?-synuclein misfolding and toxicity.
21464124 2011 The adaptor-associated kinase 1, AAK1, is a positive regulator of the Notch pathway.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19772629 2009 Genomewide association study for onset age in Parkinson disease.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18657069 2008 AAK1 regulates Numb function at an early step in clathrin-mediated endocytosis.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17494869 2007 A novel AAK1 splice variant functions at multiple steps of the endocytic pathway.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17178891 2006 Endocytic Ark/Prk kinases play a critical role in adriamycin resistance in both yeast and mammalian cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16903783 2006 Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.
16782842 2006 Unlocking the mysteries of Na+-K+-ATPase endocytosis: phosphorylation is the key.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15292237 2004 Dual engagement regulation of protein interactions with the AP-2 adaptor alpha appendage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14617351 2003 AAK1-mediated micro2 phosphorylation is stimulated by assembled clathrin.
12952931 2003 Differential requirements for AP-2 in clathrin-mediated endocytosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471243 2002 The protein kinase complement of the human genome.
11877461 2002 Identification of an adaptor-associated kinase, AAK1, as a regulator of clathrin-mediated endocytosis.
11877457 2002 Phosphorylation of the AP2 mu subunit by AAK1 mediates high affinity binding to membrane protein sorting signals.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.