Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.35
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 2.080 7.0e-06
juvenile dermatomyositis 1.021 1.2e-10
acute quadriplegic myopathy 1.013 3.2e-06
diabetes mellitus -1.100 1.3e-02
group 4 medulloblastoma -1.100 1.1e-03
posterior fossa group B ependymoma 1.100 4.8e-04
subependymal giant cell astrocytoma 1.057 1.5e-02
ulcerative colitis 1.600 9.5e-08
ovarian cancer 1.100 3.6e-05

AA Sequence

MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYI      1 - 70
CKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASS     71 - 140
GQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLV    141 - 210
GVQHVNFTNRPSVIHV                                                          211 - 226
//

Text Mined References (6)

PMID Year Title
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14710190 2004 Reconsidering the evolution of eukaryotic selenoproteins: a novel nonmammalian family with scattered phylogenetic distribution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234665 2002 Fugu and human sequence comparison identifies novel human genes and conserved non-coding sequences.