Property Summary

Ligand Count 54
NCBI Gene PubMed Count 17
PubMed Score 165.86
PubTator Score 47.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... -1.021 4.5e-02
osteosarcoma 2.387 3.5e-04
pituitary cancer -1.300 6.7e-04

 GO Component (1)

PDB (14)

Gene RIF (8)

AA Sequence

MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKR      1 - 70
ALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEP     71 - 140
AYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTS    141 - 210
ERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPL    211 - 280
IERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVP    281 - 350
AAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL    351 - 420
IKESL                                                                     421 - 425
//

Text Mined References (18)

PMID Year Title