Property Summary

NCBI Gene PubMed Count 16
PubMed Score 145.65
PubTator Score 47.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 2.387 3.5e-04
mucosa-associated lymphoid tissue lympho... -1.021 4.5e-02
pituitary cancer -1.300 6.7e-04

 GO Component (1)

Gene RIF (7)

PMID Text
24140252 Participants with major depression had lower levels of kynurenine compared to controls, with intermediate concentrations in somatoform patients.
21712776 Somatization is characterized by disorders in kynurenine aminotransferase activity and an increased neurotoxic potential
21473761 association of SNP AADAT+401C/T with the host immune response to bacterial meningitis, suggesting that this SNP may affect the host ability in recruitment of leukocytes to the infection site
20877624 Observational study of gene-disease association. (HuGE Navigator)
18056996 analysis of the crystal structure of human kynurenine aminotransferase II
18056995 analysis of the crystal structure of kynurenine aminotransferase II
12126930 A human cDNA encodes a 425-residue protein with a mitochondrial cleavage signal and a pyridoxal-phosphate binding site, ~70% identical to the mouse and rat AADAT orthologs. Bacterial expression studies confirm that the gene encodes AADAT activity.

AA Sequence

MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKR      1 - 70
ALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEP     71 - 140
AYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTS    141 - 210
ERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPL    211 - 280
IERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVP    281 - 350
AAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL    351 - 420
IKESL                                                                     421 - 425
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24140252 2013 Exercise affects symptom severity but not biological measures in depression and somatization - results on IL-6, neopterin, tryptophan, kynurenine and 5-HIAA.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
21712776 2011 Somatization, but not depression, is characterized by disorders in the tryptophan catabolite (TRYCAT) pathway, indicating increased indoleamine 2,3-dioxygenase and lowered kynurenine aminotransferase activity.
21473761 2011 Association of kynurenine aminotransferase II gene C401T polymorphism with immune response in patients with meningitis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18620547 2008 Substrate specificity and structure of human aminoadipate aminotransferase/kynurenine aminotransferase II.
18056996 2008 Crystal structure of human kynurenine aminotransferase II, a drug target for the treatment of schizophrenia.
18056995 2008 Crystal structure of human kynurenine aminotransferase II.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12126930 2002 Characterization of the human gene encoding alpha-aminoadipate aminotransferase (AADAT).
10441733 1999 Genomic organization and expression analysis of mouse kynurenine aminotransferase II, a possible factor in the pathophysiology of Huntington's disease.
8087205 1993 2-Aminoadipate-2-oxoglutarate aminotransferase isoenzymes in human liver: a plausible physiological role in lysine and tryptophan metabolism.
1798692 1991 Purification and properties of alpha-aminoadipate aminotransferase from rat liver and kidney mitochondria.