Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.6e-24
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Scabies 7 4.904 2.5
Cellulitis 20 3.936 2.0

AA Sequence

MIFEKLRICSMPQFFCFMQDLPPLKYDPDVVVTDFRFGTIPVKLYQSKASTCTLKPGIVYYHGGGGVMGS      1 - 70
LKTHHGICSRLCKESDSVVLAVGYRKLPKHKFPVPVRDCLVATIHFLKSLDAYGVDPARVVVCGDSFGGA     71 - 140
IAAVVCQQLVDRPDLPRIRAQILIYAILQALDLQTPSFQQRKNIPLLTWSFICYCFFQNLDFSSSWQEVI    141 - 210
MKGAHLPAEVWEKYRKWLGPENIPERFKERGYQLKPHEPMNEAAYLEVSVVLDVMCSPLIAEDDIVSQLP    211 - 280
ETCIVSCEYDALRDNSLLYKKRLEDLGVPVTWHHMEDGFHGVLRTIDMSFLHFPCSMRILSALVQFVKGL    281 - 350
//

Text Mined References (2)

PMID Year Title