Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.25
PubTator Score 90.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -3.300 6.5e-08
periodontitis -1.300 2.3e-24
adrenocortical carcinoma -4.343 8.5e-07
primary pancreatic ductal adenocarcinoma -2.879 6.2e-05
intraductal papillary-mucinous adenoma (... 2.400 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.800 4.7e-02
lung cancer -1.100 1.5e-02
lung adenocarcinoma -2.400 1.2e-15
aldosterone-producing adenoma -2.638 1.7e-02
lung carcinoma -1.600 2.8e-07
invasive ductal carcinoma -1.600 2.2e-02
ovarian cancer -2.900 4.3e-07
pancreatic cancer -3.000 1.5e-05

Gene RIF (8)

PMID Text
26444075 AADAC deletion is a candidate susceptibility factor for Gilles de la Tourette Syndrome
24125761 Translational N-glycosylation of AADAC plays a crucial role in regulating AADAC enzyme activity.
23542347 Lipolysis of cellular TG and VLDL production were impaired in HCV infected cells during the early peak of viral infection. This was partially explained by an apparent deficiency of a putative TG lipase, arylacetamide deacetylase (AADAC).
22415931 An AADAC*3 allele yields decreased enzyme activity in liver microsomes.
21856291 human AADAC was the enzyme responsible for the deacetylation of rifamycins and would affect the induction rate of drug-metabolizing enzymes by rifamycins and their induced hepatotoxicity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
10318829 two intrinsic endoplasmic reticulum (ER) proteins, 11beta-hydroxysteroid dehydrogenase, isozyme 1 (11beta-HSD) and the 50-kDa esterase (E3), sharing some amino acid sequence motifs in their N-terminal transmembrane (TM) domains.

AA Sequence

MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDE      1 - 70
VPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVV     71 - 140
VSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKI    141 - 210
KLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKF    211 - 280
VNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL    281 - 350
MYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL                         351 - 399
//

Text Mined References (26)

PMID Year Title
26444075 2016 Association of AADAC Deletion and Gilles de la Tourette Syndrome in a Large European Cohort.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24125761 2014 N-Glycosylation during translation is essential for human arylacetamide deacetylase enzyme activity.
23542347 2013 Arylacetamide deacetylase: a novel host factor with important roles in the lipolysis of cellular triacylglycerol stores, VLDL assembly and HCV production.
22415931 2012 A novel polymorphic allele of human arylacetamide deacetylase leads to decreased enzyme activity.
22207054 2012 Species differences in tissue distribution and enzyme activities of arylacetamide deacetylase in human, rat, and mouse.
21856291 2011 Human arylacetamide deacetylase is responsible for deacetylation of rifamycins: rifampicin, rifabutin, and rifapentine.
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19339378 2009 Human arylacetamide deacetylase is a principal enzyme in flutamide hydrolysis.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17936933 2007 Human carboxylesterases and their role in xenobiotic and endobiotic metabolism.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15152005 2004 Appropriate function of 11beta-hydroxysteroid dehydrogenase type 1 in the endoplasmic reticulum lumen is dependent on its N-terminal region sharing similar topological determinants with 50-kDa esterase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12721789 2003 Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11481320 2001 Characterization of the rodent genes for arylacetamide deacetylase, a putative microsomal lipase, and evidence for transcriptional regulation.
10318829 1999 Targeting proteins to the lumen of endoplasmic reticulum using N-terminal domains of 11beta-hydroxysteroid dehydrogenase and the 50-kDa esterase.
9665742 1998 Determination of lumenal orientation of microsomal 50-kDa esterase/N-deacetylase.
9299245 1997 Radiation hybrid mapping of human arylacetamide deacetylase (AADAC) locus to chromosome 3.
8063807 1994 Human liver arylacetamide deacetylase. Molecular cloning of a novel esterase involved in the metabolic activation of arylamine carcinogens with high sequence similarity to hormone-sensitive lipase.
2043131 1991 Purification and characterization of a human liver arylacetamide deacetylase.