Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
26224446 FER1L4 could exert a tumor suppressive impact on colon cancer, which, through suppressing miR-106a-5p expression, and depletion of FER1L4, alone or combined with overexpression of miR-106a-5p, is predictive of poor prognosis in colon cancer.
24961353 FER1L4 might play a crucial role in human gastric cancer and may be a new potential biomarker for clinical prognosis evaluation.
10192385 This publication deals with the otoferlin, which is related in sequence to FER1L4.
9175703 This publication deals with otoferlin (FER-1), which is similar to FER1L4, in both C. elegans and humans.

AA Sequence

MFSPLKSRARALAHGDPFQVSRAQDFQVGVTVLEAQKLVGVNINPYVAVQVGGQRRVTATQRGTSCPFYN      1 - 70
EYFLFEFHDTRLRLQDLLLEITAFHSQTLPFMATRIGTFRMDLGIILDQPDGQFYQRWVPLHDPRDTRAG     71 - 140
TKGFIKVTLSVRARGDLPPPMLPPAPGHCSDIEKNLLLPRGVPAERPWARLRVRLYRAEGLPALRLGLLG    141 - 210
SLVRALHDQRVLVEPYVRVSFLGQEGETSVSAEAAAPEWNEQLSFVELFPPLTRSLRLQLRDDAPLVDAA    211 - 280
LATHVPDLRRISHPGRAAGFNPTFGPAWVPLYGSPPGAGLRDSLQGLNEGVGQGIWFRGRLLLAVSMQVL    281 - 350
EGRAEPEPPQAQQGSTLSRLTRKKKKKARRDQTPKAVPQHLDASPGAEGPEIPRAMEVEVEELLPLPENV    351 - 420
LAPCEDFLLFGVLFEATMIDPTVASQPISFEISIGRAGRLEEQLGRGSRAGEGTEGAAVEAQPLLGARPE    421 - 490
EEKEEEELGTHAQRPEPMDGSGPYFCLPLCHCKPCMHVWSCWEDHTWRLQSSNCVRKVAERLDQGLQEVE    491 - 560
RLQRKPGPGACAQLKQALEVLVAGSRQFCHGAERRTMTRPNALDRCRGKLLVHSLNLLAKQGLRLLRGLR    561 - 630
RRNVQKKVALAKKLLAKLRFLAEEPQPPLPDVLVWMLSGQRRVAWARIPAQDVLFSVVEEERGRDCGKIQ    631 - 700
SLMLTAPGAAPGEVCAKLELFLRLGLGKQAKACTSELPPDLLPEPSAGLPSSLHRDDFSYFQLRAHLYQA    701 - 770
RGVLAADDSGLSDPFARVLISTQCQTTRVLEQTLSPLWDELLVFEQLIVDGRREHLQEEPPLVIINVFDH    771 - 840
NKFGPPVFLGRALAAPRVKLMEDPYQRPELQFFPLRKGPWAAGELIAAFQLIELDYSGRLEPSVPSEVEP    841 - 910
QDLAPLVEPHSGRLSLPPNVCPVLREFRVEVLFWGLRGLGRVHLLEVEQPQVVLEVAGQGVESEVLASYR    911 - 980
ESPNFTELVRHLTVDLPEQPYLQPPLSILVIERRAFGHTVLVGSHIVPHMLRFTFRGHEDPPEEEGEMEE    981 - 1050
TGDMMPKGPQGQKSLDPFLAEAGISRQLLKPPLKKLPLGGLLNQGPGLEEDIPDPEELDWGSKYYASLQE   1051 - 1120
LQGQHNFDEDEMDDPGDSDGVNLISMVGEIQDQGEAEVKGTVSPKKAVATLKIYNRSLKEEFNHFEDWLN   1121 - 1190
VFPLYRGQGGQDGGGEEEGSGHLVGKFKGSFLIYPESEAVLFSEPQISRGIPQNRPIKLLVRVYVVKATN   1191 - 1260
LAPADPNGKADPYVVVSAGRERQDTKERYIPKQLNPIFGEILELSISLPAETELTVAVFDHDLVGSDDLI   1261 - 1330
GETHIDLENRFYSHHRANCGLASQYEVDGYNAWRDAFWPSQILAGLCQRCGLPAPEYRAGAVKVGSKVFL   1331 - 1400
TPPETLPPGSSSPTVASGDPEEAQALLVLRRWQEMPGFGIQLVPEHVETRPLYHPHSPGLLQGSLHMWID   1401 - 1470
IFPQDVPAPPPVDIKPRQPISYELRVVIWNTEDVVLDDENPLTGEMSSDIYVKSWVKGLEHDKQETDVHF   1471 - 1540
NSLTGEGNFNWRFVFRFDYLPTEREVSVWRRSGPFALEEAEFRQPAVLVLQVWDYDRISANDFLGSLELQ   1541 - 1610
LPDMVRGARGPELCSVQLARNGAGPRCNLFRCRRLRGWWPVVKLKEAEDVEREAQEAQAGKKKRKQRRRK   1611 - 1680
GRPEDLEFTDMGGNVYILTGKVEAEFELLTVEEAEKRPVGKGRKQPEPLEKPSRPKTSFNWFVNPLKTFV   1681 - 1750
FFIWRRYWRTLVLLLLVLLTVFLLLVFYTIPGQISQVIFRPLHK                             1751 - 1794
//

Text Mined References (15)

PMID Year Title
26306906 2015 Long noncoding RNA FER1L4 suppresses cancer cell growth by acting as a competing endogenous RNA and regulating PTEN expression.
26224446 2015 Long non-coding RNA Fer-1-like protein 4 suppresses oncogenesis and exhibits prognostic value by associating with miR-106a-5p in colon cancer.
24961353 2014 Clinical significance of the low expression of FER1L4 in gastric cancer patients.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24063685 2013 Long non-coding RNA expression profile in human gastric cancer and its clinical significances.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
17512949 2007 In silico functional and structural characterisation of ferlin proteins by mapping disease-causing mutations and evolutionary information onto three-dimensional models of their C2 domains.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...