Property Summary

NCBI Gene PubMed Count 52
Grant Count 34
R01 Count 21
Funding $4,833,403.94
PubMed Score 47.08
PubTator Score 101.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma 1.247 0.014
tuberculosis -3.100 0.000
group 3 medulloblastoma -1.200 0.000
head and neck cancer and chronic obstruc... -1.100 0.024

Gene RIF (42)

PMID Text
26307030 AHRR methylation in monocytes may be a part of the biological link between cigarette smoking and atherosclerosis
26252179 In conclusion, offspring AHRR DNA methylation was associated with maternal obesity during pregnancy as well as infant gestational age and birth weight-for-gestational age.
24806346 Knockdown of TiPARP, but not AHRR, increased 2,3,7,8-tetrachlorodibenzo-p-dioxin - induced CYP1A1 mRNA and AHR protein levels.
24270552 The study expands the region of AHRR methylation altered in response to maternal smoking during pregnancy and reveals the tissue-specific nature of epigenetic responses to environmental exposures in utero.
23768840 Selected genetic polymorphisms in the AHR-signaling pathway (i.e., AHRR) and CLOCK may play a role in decreasing the risk for experiencing insomnia during the menopausal transition.
23648678 a high frequency of the AhRR SNP can be a risk factor in the incidence of oral cancer and other neoplasias in Papua New Guinea due to higher inducibility of CYP1A2.
23583445 TTP directly binds to the AHRR 3'UTR. TTP acts as a negative regulator of AHRR and may affect tumor development through induction of tumor suppressor genes.
23168330 Aryl hydrocarbon receptor repressor genotypes predict the inducibility of CYP1A2 in people highly exposed to toxic dioxin-like chemicals
23070629 methylation at AHRR (cg05575921) is associated with smoking status
22952704 in primary gastric adenocarcinoma, AHRR may play as a suppressor gene and its expression status has the potential to be an independent prognostic factor
More...

AA Sequence

MPRTMIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISKLDKLSV      1 - 70
LRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLLESLNGFALVVSAEGTIFYAS     71 - 140
ATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQPPPLETGDDAILGRLLRAQEWG    141 - 210
TGTPTEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLP    211 - 280
SAAEMKMRSALLRAKPRADTAATADAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQ    281 - 350
VPARAPCLCLRGGPDLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRL    351 - 420
QPSKNDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPSAYSSRTSRPMRDVGEDQVHPPLCHFPQR    421 - 490
SLQHQLPQPGAQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKMEKDSGCEGAADGCVPSQVWLG    491 - 560
ASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQPHGRATAGRSRELTPFHPAHCACLEPTDGLP    561 - 630
QSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFL    631 - 700
P//

Text Mined References (55)

PMID Year Title
26307030 2015 DNA Methylation of the Aryl Hydrocarbon Receptor Repressor Associations With Cigarette Smoking and Subclinical Atherosclerosis.
26252179 2015 Offspring DNA methylation of the aryl-hydrocarbon receptor repressor gene is associated with maternal BMI, gestational age, and birth weight.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24806346 2014 Aryl hydrocarbon receptor repressor and TiPARP (ARTD14) use similar, but also distinct mechanisms to repress aryl hydrocarbon receptor signaling.
24270552 2014 Postnatal stability, tissue, and time specific effects of AHRR methylation change in response to maternal smoking in pregnancy.
23768840 2013 Genetic polymorphisms in the aryl hydrocarbon receptor-signaling pathway and sleep disturbances in middle-aged women.
23648678 2013 Frequency of the functionally relevant aryl hydrocarbon receptor repressor (AhRR) Pro185Ala SNP in Papua New Guinea.
23583445 2013 Tristetraprolin suppresses AHRR expression through mRNA destabilization.
23168330 2013 Genetic susceptibility to dioxin-like chemicals' induction of cytochrome P4501A2 in the human adult linked to specific AhRR polymorphism.
23070629 2012 Demethylation of the aryl hydrocarbon receptor repressor as a biomarker for nascent smokers.
More...