Property Summary

NCBI Gene PubMed Count 13
Grant Count 6
R01 Count 4
Funding $752,808
PubMed Score 14.82
PubTator Score 12.24

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
24336329 Results suggest that MIF4GD is a potential regulator of p27-dependent cell proliferation in HCC.
23286197 Data suggest that oligomerization and SLBP phosphorylation regulate SLBP-SLIP1-histone-mRNA complex formation/disassociation; sequential and ordered assembly is required.
23286197 This paper describes the oligomeric state of SLIP1 and the SLIP1-SLBP complex and how it is regulated by SLBP phosphorylation. Using alanine scanning mutagenesis, the authors demonstrate that the binding site on SLIP1 for SLBP lies close to the dimer interface. A single-point mutant near the SLIP1 homodimer interface abolished interaction with SLBP in vitro and reduced the abundance of histone mRNA in vivo.
22532700 INT6 and MIF4GD were observed to colocalize in cytoplasmic foci. It was concluded that INT6, by establishing interactions with MIF4GD and SLBP, plays an important role in translation of poly(A) minus histone mRNAs.
18025107 downregulation of endogenous SLIP1 reduces the rate of translation of endogenous histone mRNA and also reduces cell viability.

AA Sequence

MGEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQA      1 - 70
GQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPD     71 - 140
SLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTP    141 - 210
AAHKYYYSEVSD                                                              211 - 222
//

Text Mined References (17)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
24336329 2015 MIF4G domain containing protein regulates cell cycle and hepatic carcinogenesis by antagonizing CDK2-dependent p27 stability.
23804756 2013 Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins.
23286197 2013 Assembly of the SLIP1-SLBP complex on histone mRNA requires heterodimerization and sequential binding of SLBP followed by SLIP1.
22532700 2012 INT6 interacts with MIF4GD/SLIP1 and is necessary for efficient histone mRNA translation.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
18025107 2008 SLIP1, a factor required for activation of histone mRNA translation by the stem-loop binding protein.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
More...