Property Summary

NCBI Gene PubMed Count 6
Grant Count 1
Funding $57,000
PubMed Score 6.13
PubTator Score 5.31

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 0.000

Synonym

Accession A9QM74 A4D277
Symbols IPOA8

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (3)

PMID Text
25272585 Bel1 fragment with residues 215-223, which bears the NLS, interacts with KPNA1, KPNA6, and KPNA7.
24275456 KPNA7 silencing inhibits the malignant properties of pancreatic cancer cells in vitro and thereby provide the first evidence on the functional role for KPNA7 in human cancer.
24045845 Our data show that compound heterozygous mutations in KPNA7 are associated with a human neurodevelopmental disease, and provide the first example of a human disease associated with mutation of a nuclear transport receptor.

AA Sequence

MPTLDAPEERRRKFKYRGKDVSLRRQQRMAVSLELRKAKKDEQTLKRRNITSFCPDTPSEKTAKGVAVSL      1 - 70
TLGEIIKGVNSSDPVLCFQATQTARKMLSQEKNPPLKLVIEAGLIPRMVEFLKSSLYPCLQFEAAWALTN     71 - 140
IASGTSEQTRAVVEGGAIQPLIELLSSSNVAVCEQAVWALGNIAGDGPEFRDNVITSNAIPHLLALISPT    141 - 210
LPITFLRNITWTLSNLCRNKNPYPCDTAVKQILPALLHLLQHQDSEVLSDACWALSYLTDGSNKRIGQVV    211 - 280
NTGVLPRLVVLMTSSELNVLTPSLRTVGNIVTGTDEQTQMAIDAGMLNVLPQLLQHNKPSIQKEAAWALS    281 - 350
NVAAGPCHHIQQLLAYDVLPPLVALLKNGEFKVQKEAVWMVANFATGATMDQLIQLVHSGVLEPLVNLLT    351 - 420
APDVKIVLIILDVISCILQAAEKRSEKENLCLLIEELGGIDRIEALQLHENRQIGQSALNIIEKHFGEEE    421 - 490
DESQTLLSQVIDQDYEFIDYECLAKK                                                491 - 516
//

Text Mined References (6)

PMID Year Title
25272585 2014 [Identification of prototype foamy virus Bel1 nuclear localization signal and its corresponding importins].
24275456 2014 KPNA7, a nuclear transport receptor, promotes malignant properties of pancreatic cancer cells in vitro.
24045845 2014 Autosomal recessive mutations in nuclear transport factor KPNA7 are associated with infantile spasms and cerebellar malformation.
20701745 2010 Karyopherin alpha7 (KPNA7), a divergent member of the importin alpha family of nuclear import receptors.
20228798 2010 Genome-wide association study for ulcerative colitis identifies risk loci at 7q22 and 22q13 (IL17REL).
12690205 2003 Human chromosome 7: DNA sequence and biology.