Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.25
PubTator Score 5.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 2.5e-09
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
ulcerative colitis 1819 0.0 3.0
Disease Target Count Z-score Confidence
Lennox-Gastaut syndrome 34 3.564 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 2.5e-09

Synonym

Accession A9QM74 A4D277
Symbols IPOA8

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MPTLDAPEERRRKFKYRGKDVSLRRQQRMAVSLELRKAKKDEQTLKRRNITSFCPDTPSEKTAKGVAVSL      1 - 70
TLGEIIKGVNSSDPVLCFQATQTARKMLSQEKNPPLKLVIEAGLIPRMVEFLKSSLYPCLQFEAAWALTN     71 - 140
IASGTSEQTRAVVEGGAIQPLIELLSSSNVAVCEQAVWALGNIAGDGPEFRDNVITSNAIPHLLALISPT    141 - 210
LPITFLRNITWTLSNLCRNKNPYPCDTAVKQILPALLHLLQHQDSEVLSDACWALSYLTDGSNKRIGQVV    211 - 280
NTGVLPRLVVLMTSSELNVLTPSLRTVGNIVTGTDEQTQMAIDAGMLNVLPQLLQHNKPSIQKEAAWALS    281 - 350
NVAAGPCHHIQQLLAYDVLPPLVALLKNGEFKVQKEAVWMVANFATGATMDQLIQLVHSGVLEPLVNLLT    351 - 420
APDVKIVLIILDVISCILQAAEKRSEKENLCLLIEELGGIDRIEALQLHENRQIGQSALNIIEKHFGEEE    421 - 490
DESQTLLSQVIDQDYEFIDYECLAKK                                                491 - 516
//

Text Mined References (6)

PMID Year Title