Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.37
PubTator Score 0.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Infertility 163 3.296 1.6

AA Sequence

MKTILGFKGLFYLHSLIWTCAGDWSAIQVHCTQFWFFARIKPTIFYNLYVNPDEVFLGDGCHVTHVLPNV      1 - 70
YYEFFYHPHDCGIVTQPLQEVLLLKTKIRYISRDSTVRSEMPLSCVVHKQKCQ                      71 - 123
//

Text Mined References (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
11747200 2001 Oosp1 encodes a novel mouse oocyte-secreted protein.