Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.37
PubTator Score 0.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Infertility 188 3.281 1.6

AA Sequence

MKTILGFKGLFYLHSLIWTCAGDWSAIQVHCTQFWFFARIKPTIFYNLYVNPDEVFLGDGCHVTHVLPNV      1 - 70
YYEFFYHPHDCGIVTQPLQEVLLLKTKIRYISRDSTVRSEMPLSCVVHKQKCQ                      71 - 123
//

Text Mined References (2)

PMID Year Title