Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.03

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MEALVYAVSQAQGRPGHPDAPPNIYEGGLGSPQPQCPSAQGSKPKNFRLRHLRGLGLYLESHPPPTGQCE      1 - 70
SHWLGRLMAGGCLPQPEGTAWALDLPQGTLGPRNSLCSALLEARLPRDSLGSSASSSSMDPDKGALPQPS     71 - 140
PSRLRPKRSWGTWEEAMCPLCKRTRSGALERP                                          141 - 172
//

Text Mined References (2)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).