Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 0.000

Synonym

Accession A8MZF0 A6NI49
Symbols C11orf89

Gene

 Compartment GO Term (0)

AA Sequence

MGPQVVASAPEPTRPPSGFVPVSGGGGTHVTQVHIQLAPSPHNGTPEPPRTAPEVGSNSQDGDATPSPPR      1 - 70
AQPLVPVAHIRPLPTTVQAASPLPEEPPVPRPPPGFQASVPREASARVVVPIAPTCRSLESSPHSLVPMG     71 - 140
PGREHLEEPPMAGPAAEAERVSSPAWASSPTPPSGPHPCPVPKVAPKPRLSGWTWLKKQLLEEAPEPPCP    141 - 210
EPRQSLEPEVPTPTEQEVPAPTEQEVPALTAPRAPASRTSRMWDAVLYRMSVAEAQGRLAGPSGGEHTPA    211 - 280
SLTRLPFLYRPRFNARKLQEATRPPPTVRSILELSPQPKNFNRTATGWRLQ                       281 - 331
//

Text Mined References (4)

PMID Year Title
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
17529967 2007 Genome-wide association study identifies novel breast cancer susceptibility loci.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.