Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.33
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Synonym

Accession A8MZ97 C9JP62
Symbols

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG

AA Sequence

MSLLAKPMSFETTAITFFIILLICLICILLLLVVFLYKCFQGRKGKETKKVPCTDANGGVDCAAAKVVTS      1 - 70
NPEDHERILMQVMNLNVPMRPGILVQRQSKEVLATPLENRRDMEAEEENQINEKQEPENAGETGQEEDDG     71 - 140
LQKIHTSVTRTPSVVESQKRPLKGVTFSREVIVVDLGNEYPTPRSYTREHKERK                    141 - 194
//

Text Mined References (5)

PMID Year Title
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.