Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.33
PubTator Score 0.13

Knowledge Summary

Patent

No data available

AA Sequence

MSLLAKPMSFETTAITFFIILLICLICILLLLVVFLYKCFQGRKGKETKKVPCTDANGGVDCAAAKVVTS      1 - 70
NPEDHERILMQVMNLNVPMRPGILVQRQSKEVLATPLENRRDMEAEEENQINEKQEPENAGETGQEEDDG     71 - 140
LQKIHTSVTRTPSVVESQKRPLKGVTFSREVIVVDLGNEYPTPRSYTREHKERK                    141 - 194
//

Text Mined References (5)

PMID Year Title