Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.41
PubTator Score 1.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 1.3e-73
Disease Target Count Z-score Confidence
Angiosarcoma 11 3.09 1.5

Gene RIF (1)

AA Sequence

MHPSLATMGKLASKLQLDLSVVKIWFKNQRAKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANI      1 - 70
RPVSPGISDANDHDLREPSGIKNPGGASASARVSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVKIYD     71 - 140
LPGEDDTSSLNQYLFPVCLEYDQLQSSV                                              141 - 168
//

Text Mined References (5)

PMID Year Title