Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.41
PubTator Score 1.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MHPSLATMGKLASKLQLDLSVVKIWFKNQRAKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANI      1 - 70
RPVSPGISDANDHDLREPSGIKNPGGASASARVSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVKIYD     71 - 140
LPGEDDTSSLNQYLFPVCLEYDQLQSSV                                              141 - 168
//

Text Mined References (4)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17963489 2007 Classification and nomenclature of all human homeobox genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
11181995 2001 The sequence of the human genome.