Knowledge Summary

Patent

No data available

Synonym

Accession A8MZ25
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGQKKTMGTERSRGGKRGPQPGAERPEEPGATFSKKPPEGARAPRCLSRPTAPKSGACLARRRPPGSPCS      1 - 70
IRDAPFHTGDDRFLARENFPNVLQPLPRMFAVQQAADFESQCPRRWDSRKRPSEGLPSAGWGRWRGRPIH     71 - 140
LGLWVSGSVRRKVSGSHVSRSLHL                                                  141 - 164
//

Text Mined References (3)

PMID Year Title