Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
R01 Count 4
Funding $650,757
PubMed Score 16.15
PubTator Score 7.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 2.900 0.000
medulloblastoma, large-cell 1.800 0.008
juvenile dermatomyositis 1.356 0.000
interstitial cystitis -1.300 0.000
pituitary cancer 1.300 0.000
psoriasis -1.800 0.000

Gene RIF (8)

PMID Text
25695151 In conclusion, the results of the present study indicated that the FOXO6/USP7 molecular network has an important role in the regulation of lung cancer development.
23714368 FOXO6 induces C-myc expression by associating to HNF4 and mediating histone acetylation, and the dissociation of HDAC3 from the promoter of the C-myc gene
23324123 Studies indicate that FoxO6 is produced in the liver of both rodents and humans.
21940782 investigation of role of FoxO6 in liver: Data suggest that a FoxO6-dependent pathway in hepatocytes orchestrates insulin regulation of gluconeogenesis.
21708191 Studies indictet that the mammalian FoxO family consists of FoxO1, 3, 4 and 6 and are regulated by by AKT and 14-3-3 proteins.
21388494 gene study of FOXO6, reveals no association with human longevity in Germans
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12857750 cloning and characterization; structural and functional properties related to gene regulation

AA Sequence

MAAKLRAHQVDVDPDFAPQSRPRSCTWPLPQPDLAGDEDGALGAGVAEGAEDCGPERRATAPAMAPAPPL      1 - 70
GAEVGPLRKAKSSRRNAWGNLSYADLITKAIESAPDKRLTLSQIYDWMVRYVPYFKDKGDSNSSAGWKNS     71 - 140
IRHNLSLHTRFIRVQNEGTGKSSWWMLNPEGGKTGKTPRRRAVSMDNGAKFLRIKGKASKKKQLQAPERS    141 - 210
PDDSSPSAPAPGPVPAAAKWAASPASHASDDYEAWADFRGGGRPLLGEAAELEDDEALEALAPSSPLMYP    211 - 280
SPASALSPALGSRCPGELPRLAELGGPLGLHGGGGAGLPEGLLDGAQDAYGPRPAPRPGPVLGAPGELAL    281 - 350
AGAAAAYPGKGAAPYAPPAPSRSALAHPISLMTLPGEAGAAGLAPPGHAAAFGGPPGGLLLDALPGPYAA    351 - 420
AAAGPLGAAPDRFPADLDLDMFSGSLECDVESIILNDFMDSDEMDFNFDSALPPPPPGLAGAPPPNQSWV    421 - 490
PG                                                                        491 - 492
//

Text Mined References (10)

PMID Year Title
25695151 2015 FoxO6 inhibits cell proliferation in lung carcinoma through up-regulation of USP7.
23714368 2013 FOXO6 promotes gastric cancer cell tumorigenicity via upregulation of C-myc.
23324123 2013 FoxO6 in glucose metabolism (FoxO6).
21940782 2011 FoxO6 integrates insulin signaling with gluconeogenesis in the liver.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21708191 2011 FoxO transcription factors; Regulation by AKT and 14-3-3 proteins.
21388494 2011 Candidate gene study of FOXO1, FOXO4, and FOXO6 reveals no association with human longevity in Germans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12857750 2003 FoxO6, a novel member of the FoxO class of transcription factors with distinct shuttling dynamics.