Property Summary

NCBI Gene PubMed Count 11
PubMed Score 17.20
PubTator Score 7.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 2.900 1.3e-05
interstitial cystitis -1.300 4.3e-04
juvenile dermatomyositis 1.356 3.9e-09
medulloblastoma, large-cell 1.800 7.8e-03
pituitary cancer 1.300 7.0e-06
psoriasis -1.800 4.1e-56

Gene RIF (8)

AA Sequence

MAAKLRAHQVDVDPDFAPQSRPRSCTWPLPQPDLAGDEDGALGAGVAEGAEDCGPERRATAPAMAPAPPL      1 - 70
GAEVGPLRKAKSSRRNAWGNLSYADLITKAIESAPDKRLTLSQIYDWMVRYVPYFKDKGDSNSSAGWKNS     71 - 140
IRHNLSLHTRFIRVQNEGTGKSSWWMLNPEGGKTGKTPRRRAVSMDNGAKFLRIKGKASKKKQLQAPERS    141 - 210
PDDSSPSAPAPGPVPAAAKWAASPASHASDDYEAWADFRGGGRPLLGEAAELEDDEALEALAPSSPLMYP    211 - 280
SPASALSPALGSRCPGELPRLAELGGPLGLHGGGGAGLPEGLLDGAQDAYGPRPAPRPGPVLGAPGELAL    281 - 350
AGAAAAYPGKGAAPYAPPAPSRSALAHPISLMTLPGEAGAAGLAPPGHAAAFGGPPGGLLLDALPGPYAA    351 - 420
AAAGPLGAAPDRFPADLDLDMFSGSLECDVESIILNDFMDSDEMDFNFDSALPPPPPGLAGAPPPNQSWV    421 - 490
PG                                                                        491 - 492
//

Text Mined References (11)

PMID Year Title