Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.29966772915446E-6
glioblastoma 5572 2.04000948059421E-5
adult high grade glioma 2148 6.929454733429E-4

AA Sequence

MVRRTLLQAALRAWVIQCWWRSMQAKMLEQRRRLALRLYTCQEWAVVKVQAQVRMWQARRRFLQARQAAC      1 - 70
IIQSHWRWHASQTRGLIRGHYEVRASRLELDIEILMT                                      71 - 107
//

Text Mined References (1)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.