Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession A8MYZ5
Symbols

Gene

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MVRRTLLQAALRAWVIQCWWRSMQAKMLEQRRRLALRLYTCQEWAVVKVQAQVRMWQARRRFLQARQAAC      1 - 70
IIQSHWRWHASQTRGLIRGHYEVRASRLELDIEILMT                                      71 - 107
//

Text Mined References (1)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.