Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 7.3e-06

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 7.3e-06

Synonym

Accession A8MYX2
Symbols FAM25D

Gene

 Compartment GO Term (0)

AA Sequence

MSQSVLAGGGIPEPHLGCPGTYRSIVRINGSALSPHPGLRGHEPALSPLPGLGGHWACSEPSPWTQEGSG      1 - 70
PALSPHPGLWGQWACSEPSSWTRGQRACSEPSPWTCLLCSVHAMEEVVKEVVGHAKETGEKAIAEAIKKA     71 - 140
QESGDKKMKEVTETVTNTVTNAITHAAESLGKLGQ                                       141 - 175
//

Text Mined References (1)

PMID Year Title