Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 0.000

Synonym

Accession A8MYX2
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MSQSVLAGGGIPEPHLGCPGTYRSIVRINGSALSPHPGLRGHEPALSPLPGLGGHWACSEPSPWTQEGSG      1 - 70
PALSPHPGLWGQWACSEPSSWTRGQRACSEPSPWTCLLCSVHAMEEVVKEVVGHAKETGEKAIAEAIKKA     71 - 140
QESGDKKMKEVTETVTNTVTNAITHAAESLGKLGQ                                       141 - 175
//

Text Mined References (1)

PMID Year Title
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.