Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 0.000

Synonym

Accession A8MYV0
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MGTRGPSAPVDTTPAKTIVVYRNGDPFYVGKKFVLSRRRAATFEALLEQLTEQVDVPFGVRRLFTPTRGH      1 - 70
RVLGLDALQAGGKYVAAGRERFKELDYIHIVPRKPAKIRKLKEIKPVVHCDINVPSKWQTYHRISRHINV     71 - 140
FTNGRLFIPPAKIIIPKFSLSDWDIVLATIGEKVFPLGGVRKLFTMNGHLLGDSKDLQDNHFYVAVGLET    141 - 210
FKYFPYWKSPRVPSEVQQRYANVEKNSQRKKKVDSKGKEPCKYDGIPPKTQDSVYYAKEEKKKTLAEPLV    211 - 280
QRGAEGDVYKAPTPSKETQGALDVKEEHNVQLEVPVDQAESSCDKHCCHNFAYNKHIHKFWLPVILISID    281 - 350
FEAVE                                                                     351 - 355
//

Text Mined References (6)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
20236041 2010 The doublecortin gene family and disorders of neuronal structure.
16869982 2006 The evolving doublecortin (DCX) superfamily.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.