Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.63
PubTator Score 0.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
posterior fossa group B ependymoma 4.600 0.000
osteosarcoma -2.126 0.000
juvenile dermatomyositis 2.765 0.000
Atopic dermatitis 1.700 0.000
tuberculosis 1.900 0.000
non-small cell lung cancer -1.312 0.000
active Crohn's disease 1.077 0.017
ulcerative colitis 1.500 0.000
interstitial cystitis 1.800 0.001
nasopharyngeal carcinoma -1.400 0.000
Endometriosis -1.455 0.015
lung carcinoma -1.100 0.000
ovarian cancer 2.000 0.000
psoriasis 1.400 0.000

Synonym

Accession A8MYP8 A0PK18
Symbols ODF3L3

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSDAWVGLWRPHRPRGPIAAHYGGPGPKYKLPPNTGYALHDPSRPRAPAFTFGARFPTQQTTCGPGPGH      1 - 70
LVPARMTVRGTDGAPAYSIYGRPRRSAPFLTPGPGRYFPERAGNATYPSAPRHTIAPRNWGVQAEQQSPG     71 - 140
PAAYTVPSLLGPRVIGKVSAPTCSIYGRRAAGSFFEDLSKTPGPCAYQVVSPGVYKSRAPQFTILARTSL    141 - 210
PQDNTRKPGPAAYNVDQHRKPRGWSFGIRHSDYLAPLVTDADN                               211 - 253
//

Text Mined References (13)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
More...