Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.63
PubTator Score 0.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.077 1.7e-02
active ulcerative colitis 1.381 1.7e-02
Atopic dermatitis 1.700 3.8e-05
Endometriosis -1.455 1.5e-02
ependymoma 3.700 4.3e-02
interstitial cystitis 1.800 8.5e-04
juvenile dermatomyositis 2.765 1.3e-15
lung carcinoma -1.100 1.9e-09
nasopharyngeal carcinoma -1.400 4.5e-04
non-small cell lung cancer -1.312 1.4e-12
osteosarcoma -2.126 1.6e-05
ovarian cancer -1.100 3.7e-03
psoriasis 1.400 1.8e-27
tuberculosis 1.900 2.5e-04

Synonym

Accession A8MYP8 A0PK18
Symbols ODF3L3

Gene

PANTHER Protein Class (1)

  Ortholog (2)

Species Source Disease
OMA EggNOG
OMA EggNOG

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MGSDAWVGLWRPHRPRGPIAAHYGGPGPKYKLPPNTGYALHDPSRPRAPAFTFGARFPTQQTTCGPGPGH      1 - 70
LVPARMTVRGTDGAPAYSIYGRPRRSAPFLTPGPGRYFPERAGNATYPSAPRHTIAPRNWGVQAEQQSPG     71 - 140
PAAYTVPSLLGPRVIGKVSAPTCSIYGRRAAGSFFEDLSKTPGPCAYQVVSPGVYKSRAPQFTILARTSL    141 - 210
PQDNTRKPGPAAYNVDQHRKPRGWSFGIRHSDYLAPLVTDADN                               211 - 253
//

Text Mined References (13)

PMID Year Title