Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
19096130 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEDVGQNPLDDVKNIFFASSLEAVKQNLDCLNSDLEKDLQKLDMENQVLLRKIKEKEETISSLERKLALS      1 - 70
LEEAKEEEELNYVIDEQEESLRELELETAKLEKSNAILSRNVVEVQKKISGLFTNIGLEEETTKQILEEM     71 - 140
KARLQKSTESCAKQEEELAKIESDYQSVSDLCKDQVYYIKKYQEVLRKMKEEKETLLLEKQISKAQDDSS    141 - 210
QTVKPGSILADTTQRNMERTTIKKQERRCWYKYFQYLTFMVLVFIRLLAYVIFHLQYINPDLLVDVLPLV    211 - 280
LSRGTLESLRKVSHPFLTLAVEEALPH                                               281 - 307
//

Text Mined References (3)

PMID Year Title
19096130 2008 Microsatellite scan identifies new candidate genes for susceptibility to alcoholic chronic pancreatitis in Japanese patients.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.