Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A8MY62
Symbols

Gene

PANTHER Protein Class (3)

  Ortholog (4)

Species Source
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

 Compartment GO Term (0)

AA Sequence

MCPRHPEPVPLAHPLPVLKEALEKVDQILRQAMSAPGVAAMSAVVIHNDTVLWTGNFGKKNGSDPASGAP      1 - 70
NEYTMYRISSISKIFPVLMLYRLWEEGIVASLDDPLERYASTFTINNPLGLASAEQQGLILRRMASQLSG     71 - 140
LPRRLRSTSLLWKGSTQEALNLLKDDVLVVDPGTRCHYSTLAFSLLAHVLAAHTAQGDYQRWVSENVLEP    141 - 210
LGMADTGFDLTPDVRARLAAGFYGSGRPAPLYDLGWYRPSGQMYSTAADLAKLAVALLGGGPRRLLRPDA    211 - 280
AKTLLAPLLACPGAYFANETGTPWEFHAQRGYRVVRKDGDLDGYAATFSLVPPLRLGLVLLLAGPRPPGP    281 - 350
DLVARAYDELLPALERALREAEPGPAPPPTAHPFAGYFTFANLTFYEVRAGPAGELRLRQFGPRVEALVP    351 - 420
PAFRTLALRHLHGRVFQLHVAHEFPCALPLGDAWLSLEAQHGQLVNFYPLDHHGLSPGFDVPGLNTYRVL    421 - 490
RLRGKPVFKT                                                                491 - 500
//

Text Mined References (1)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.