Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.09
PubTator Score 0.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.8e-03
Disease Target Count Z-score Confidence
Peripheral vascular disease 87 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.600 1.8e-03

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MSSSLRPGPSRWRRAASIVLAAGWSRPETATPPSRPPPAEGFRLLLLQRSPHQGFMPGAHVFSGGVLDAA      1 - 70
DRSADWLGLFAPHHGPPRFGLGPAPFSRTAFPSLPDTDDHKTDNTGTLPEDVAFRICAVREAFEEAGVLL     71 - 140
LRPRTSPPGPAPGPGLALEPPPGLASWRDRVRQDPRHFLRLCAHLDCTPDIWALHNWSAWLTPFLRGTTR    141 - 210
RFDTAFFLCCLREPPPVYPDLAEVVGYQWSSPSEATESFLSKEIWLPPPQFYEVRRLANFASLSDLHKFC    211 - 280
LGRALEGLERWLPIILLTADGMVHLLPGDELYLEDSDFLENLMSTEKKTEEIMKEGKQFHRIVTYHRHLY    281 - 350
DIHVTVQPKYKHVYPKNSVVRKSHL                                                 351 - 375
//

Text Mined References (10)

PMID Year Title