Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.31

Knowledge Summary

Patent

No data available

AA Sequence

MRIAVLFFTIFFFMSQVLPAKGKFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTP      1 - 70
KKD                                                                        71 - 73
//

Text Mined References (3)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
12734011 2003 Duplication and selection in the evolution of primate beta-defensin genes.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.