Knowledge Summary

Patent

No data available

Synonym

Accession A8MXK9 A8MTZ3 Q9H627
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MLCPCIQESTFETCLFMAVSRMSKWRLSRVGGSRSLPAEMEVLGEVWCVRAEEQPMTGLGIVWHSPLDKA      1 - 70
LETWSLQQQPDFSLGLGHLGLGTDATWMQSFPGSGGDAQAGTGVSGPLRLYPNLLCDFGPRQGPLWALLL     71 - 140
EKRQMAGTGGSPALLAWRSASWRALG                                                141 - 166
//

Text Mined References (3)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.